Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8P7J7

Protein Details
Accession B8P7J7    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
70-89LTHSKLQKFKHKKVCQECRDHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 9, cysk 9, nucl 5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000313  PWWP_dom  
KEGG ppl:POSPLDRAFT_101044  -  
Pfam View protein in Pfam  
PF00855  PWWP  
PROSITE View protein in PROSITE  
PS50812  PWWP  
CDD cd05839  PWWP_BRPF  
Amino Acid Sequences MDAFPWWPAVIFESDDPYVPPEVFRFHKAPQGGDLTHLVRFFDKRNSWQWVPLDKLRMLGEDNEFDELMLTHSKLQKFKHKKVCQECRDAYRRAMAEKETDGEGDHAPESEDDTMAIVNEPPAITEPPAEVSTSVMIQDDGLGGDSPMTEVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.18
4 0.18
5 0.17
6 0.15
7 0.15
8 0.12
9 0.17
10 0.2
11 0.24
12 0.26
13 0.26
14 0.32
15 0.33
16 0.33
17 0.31
18 0.33
19 0.28
20 0.27
21 0.29
22 0.24
23 0.24
24 0.23
25 0.2
26 0.16
27 0.18
28 0.18
29 0.23
30 0.26
31 0.29
32 0.35
33 0.42
34 0.41
35 0.45
36 0.47
37 0.43
38 0.45
39 0.43
40 0.41
41 0.34
42 0.35
43 0.3
44 0.26
45 0.22
46 0.19
47 0.17
48 0.14
49 0.14
50 0.13
51 0.12
52 0.11
53 0.1
54 0.08
55 0.07
56 0.07
57 0.07
58 0.08
59 0.12
60 0.14
61 0.18
62 0.21
63 0.3
64 0.38
65 0.47
66 0.56
67 0.59
68 0.66
69 0.73
70 0.81
71 0.76
72 0.76
73 0.71
74 0.68
75 0.67
76 0.6
77 0.51
78 0.45
79 0.41
80 0.34
81 0.32
82 0.25
83 0.22
84 0.2
85 0.21
86 0.16
87 0.15
88 0.14
89 0.13
90 0.12
91 0.11
92 0.1
93 0.08
94 0.08
95 0.08
96 0.1
97 0.09
98 0.08
99 0.07
100 0.07
101 0.07
102 0.07
103 0.07
104 0.05
105 0.05
106 0.06
107 0.06
108 0.06
109 0.09
110 0.1
111 0.1
112 0.1
113 0.11
114 0.14
115 0.14
116 0.14
117 0.12
118 0.12
119 0.13
120 0.13
121 0.12
122 0.09
123 0.09
124 0.08
125 0.08
126 0.07
127 0.06
128 0.07
129 0.07
130 0.06
131 0.06
132 0.07