Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2J0K1

Protein Details
Accession A0A1X2J0K1    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
59-81LWAAPKKKTSHSKKRMRASNKGLHydrophilic
NLS Segment(s)
PositionSequence
63-76PKKKTSHSKKRMRA
Subcellular Location(s) mito 15, mito_nucl 13.833, nucl 10.5, cyto_nucl 6.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences MITSVLSATRSNTRQLAFQSNGTLRLSPLASIGQWINSTLNTNVNNNTFQVPSWLGPILWAAPKKKTSHSKKRMRASNKGLQQKENIVACPACGNTKLLHHVCKQCYGEIKQKAKNLEMA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.35
3 0.4
4 0.34
5 0.34
6 0.37
7 0.34
8 0.36
9 0.33
10 0.29
11 0.21
12 0.21
13 0.2
14 0.14
15 0.13
16 0.11
17 0.1
18 0.12
19 0.12
20 0.1
21 0.1
22 0.11
23 0.1
24 0.1
25 0.12
26 0.11
27 0.15
28 0.15
29 0.17
30 0.18
31 0.19
32 0.2
33 0.18
34 0.19
35 0.15
36 0.13
37 0.14
38 0.13
39 0.11
40 0.12
41 0.11
42 0.1
43 0.09
44 0.1
45 0.08
46 0.1
47 0.12
48 0.12
49 0.15
50 0.19
51 0.2
52 0.27
53 0.37
54 0.45
55 0.54
56 0.63
57 0.7
58 0.76
59 0.83
60 0.86
61 0.82
62 0.82
63 0.79
64 0.77
65 0.74
66 0.75
67 0.68
68 0.61
69 0.56
70 0.5
71 0.48
72 0.4
73 0.33
74 0.26
75 0.23
76 0.21
77 0.2
78 0.17
79 0.13
80 0.13
81 0.14
82 0.12
83 0.16
84 0.24
85 0.26
86 0.31
87 0.36
88 0.44
89 0.45
90 0.51
91 0.5
92 0.46
93 0.5
94 0.5
95 0.53
96 0.55
97 0.61
98 0.59
99 0.63
100 0.64