Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2IVZ4

Protein Details
Accession A0A1X2IVZ4   
Localization Confidence High
Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-34GNTSSKSTASQRRPSHKHKKPLKENPPTRSPTQHydrophilic
NLS Segment(s)
PositionSequence
13-24RRPSHKHKKPLK
Subcellular Location(s) nucl 18, mito 4, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR041698  Methyltransf_25  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0008168  F:methyltransferase activity  
GO:0032259  P:methylation  
Pfam View protein in Pfam  
PF13649  Methyltransf_25  
CDD cd02440  AdoMet_MTases  
Amino Acid Sequences MGNTSSKSTASQRRPSHKHKKPLKENPPTRSPTQRTIDGRIYHAVDGSQYLLPRDDQEVDRLHETHFLTKELLGCNVMADAIKTLDFQGGGLQILDVCCGPATWLCETSLDYPSCQFVGIDMCSIWPQVIRPANLEFIEANVLRGLPFPDKAFDFVQLRFVSLAFKTNEWDYILTEIRRVLRDGGVLQCIDLDMQIISDDQDIKRYLQHFDALCNTRGLDPSAGAKLDMMLNDHGLNILQSEYREIPLGWGGPLGDGFMNIFSAEVQGLAPWMKRSSNLNDEQLIAMLRRTLRGMIQSKAYMGLYAFLAQKPFDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.84
3 0.87
4 0.86
5 0.88
6 0.88
7 0.9
8 0.91
9 0.93
10 0.93
11 0.93
12 0.92
13 0.9
14 0.89
15 0.83
16 0.78
17 0.77
18 0.72
19 0.7
20 0.67
21 0.68
22 0.63
23 0.64
24 0.66
25 0.58
26 0.55
27 0.5
28 0.46
29 0.37
30 0.33
31 0.26
32 0.19
33 0.17
34 0.17
35 0.14
36 0.12
37 0.13
38 0.13
39 0.14
40 0.15
41 0.17
42 0.18
43 0.18
44 0.22
45 0.24
46 0.26
47 0.28
48 0.27
49 0.25
50 0.27
51 0.27
52 0.29
53 0.27
54 0.25
55 0.23
56 0.23
57 0.26
58 0.22
59 0.22
60 0.16
61 0.15
62 0.13
63 0.12
64 0.11
65 0.08
66 0.06
67 0.06
68 0.06
69 0.06
70 0.06
71 0.07
72 0.07
73 0.07
74 0.07
75 0.08
76 0.08
77 0.08
78 0.07
79 0.07
80 0.06
81 0.06
82 0.07
83 0.05
84 0.05
85 0.04
86 0.04
87 0.05
88 0.06
89 0.09
90 0.1
91 0.11
92 0.11
93 0.12
94 0.14
95 0.16
96 0.2
97 0.18
98 0.17
99 0.16
100 0.17
101 0.16
102 0.14
103 0.11
104 0.07
105 0.09
106 0.09
107 0.09
108 0.08
109 0.08
110 0.08
111 0.08
112 0.08
113 0.05
114 0.05
115 0.11
116 0.15
117 0.15
118 0.17
119 0.19
120 0.21
121 0.21
122 0.21
123 0.14
124 0.11
125 0.14
126 0.12
127 0.11
128 0.08
129 0.08
130 0.07
131 0.08
132 0.09
133 0.07
134 0.08
135 0.08
136 0.1
137 0.1
138 0.13
139 0.13
140 0.14
141 0.15
142 0.14
143 0.19
144 0.18
145 0.18
146 0.15
147 0.15
148 0.13
149 0.11
150 0.16
151 0.11
152 0.11
153 0.12
154 0.12
155 0.14
156 0.13
157 0.13
158 0.09
159 0.12
160 0.14
161 0.12
162 0.13
163 0.13
164 0.14
165 0.15
166 0.15
167 0.13
168 0.12
169 0.13
170 0.14
171 0.14
172 0.14
173 0.13
174 0.12
175 0.1
176 0.09
177 0.08
178 0.06
179 0.05
180 0.03
181 0.03
182 0.04
183 0.04
184 0.04
185 0.05
186 0.07
187 0.07
188 0.1
189 0.11
190 0.12
191 0.15
192 0.17
193 0.18
194 0.17
195 0.22
196 0.2
197 0.21
198 0.28
199 0.28
200 0.27
201 0.26
202 0.25
203 0.21
204 0.22
205 0.21
206 0.14
207 0.12
208 0.13
209 0.14
210 0.14
211 0.13
212 0.11
213 0.1
214 0.11
215 0.1
216 0.1
217 0.09
218 0.1
219 0.1
220 0.1
221 0.09
222 0.08
223 0.08
224 0.06
225 0.06
226 0.06
227 0.06
228 0.1
229 0.11
230 0.11
231 0.13
232 0.12
233 0.13
234 0.14
235 0.14
236 0.11
237 0.1
238 0.1
239 0.09
240 0.09
241 0.08
242 0.06
243 0.06
244 0.06
245 0.06
246 0.06
247 0.05
248 0.06
249 0.05
250 0.05
251 0.05
252 0.05
253 0.05
254 0.05
255 0.06
256 0.08
257 0.09
258 0.11
259 0.13
260 0.14
261 0.16
262 0.22
263 0.29
264 0.36
265 0.41
266 0.43
267 0.42
268 0.43
269 0.4
270 0.36
271 0.29
272 0.21
273 0.15
274 0.15
275 0.14
276 0.14
277 0.15
278 0.16
279 0.17
280 0.26
281 0.3
282 0.29
283 0.34
284 0.33
285 0.33
286 0.34
287 0.31
288 0.23
289 0.19
290 0.17
291 0.13
292 0.15
293 0.17
294 0.16
295 0.17