Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8PEN2

Protein Details
Accession B8PEN2    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
224-252QQSPHAQQGQQQRRRRRQPQAPGQHPQFRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
KEGG ppl:POSPLDRAFT_95358  -  
Amino Acid Sequences MTPERAKANYYARLKVEHGWQRQNLNEVENLYFRHTHMHRPPPIIPAGGRRTAGLSLASASSTSNTLSPVNEPRLNPPAHAILPDSQFTGTAGQGTDPFPPQASVSLAPIYQSHTQLRTVGAAQIGGPSIGTGSNGHFVAHAQSVATPSTPSSSAAAFQLAAPPPFGYPPAMPPQSFAYAHPSHTPSSMPPTIPYSPPPTAPPNGPNSRHTVSPHLPEPPQQPQQSPHAQQGQQQRRRRRQPQAPGQHPQFRPIAPATTRPQGSPAPAPAPAPPSPAPAPAMLNFPPTQGSGMTYDTFWSSHSSLSAQTFRNVILNSAALFAPPPQGEQMQPQGMGEPTDSQLGAAYPNSAMHSDALNLNGMTWPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.47
3 0.5
4 0.5
5 0.53
6 0.55
7 0.58
8 0.6
9 0.6
10 0.62
11 0.54
12 0.47
13 0.42
14 0.35
15 0.33
16 0.29
17 0.28
18 0.25
19 0.25
20 0.22
21 0.28
22 0.27
23 0.35
24 0.42
25 0.51
26 0.54
27 0.58
28 0.61
29 0.57
30 0.58
31 0.51
32 0.43
33 0.42
34 0.42
35 0.4
36 0.38
37 0.33
38 0.32
39 0.3
40 0.29
41 0.2
42 0.15
43 0.12
44 0.12
45 0.11
46 0.09
47 0.09
48 0.09
49 0.09
50 0.09
51 0.08
52 0.1
53 0.11
54 0.12
55 0.16
56 0.21
57 0.27
58 0.31
59 0.31
60 0.35
61 0.41
62 0.41
63 0.37
64 0.34
65 0.32
66 0.28
67 0.28
68 0.25
69 0.22
70 0.24
71 0.24
72 0.21
73 0.17
74 0.16
75 0.16
76 0.15
77 0.11
78 0.09
79 0.09
80 0.08
81 0.1
82 0.11
83 0.13
84 0.12
85 0.13
86 0.12
87 0.13
88 0.12
89 0.12
90 0.14
91 0.13
92 0.13
93 0.14
94 0.13
95 0.13
96 0.13
97 0.15
98 0.16
99 0.18
100 0.19
101 0.19
102 0.2
103 0.21
104 0.21
105 0.19
106 0.17
107 0.15
108 0.13
109 0.11
110 0.1
111 0.1
112 0.09
113 0.07
114 0.06
115 0.04
116 0.04
117 0.04
118 0.05
119 0.05
120 0.06
121 0.08
122 0.09
123 0.09
124 0.09
125 0.09
126 0.1
127 0.1
128 0.09
129 0.07
130 0.07
131 0.08
132 0.09
133 0.09
134 0.07
135 0.06
136 0.08
137 0.08
138 0.09
139 0.09
140 0.09
141 0.09
142 0.09
143 0.09
144 0.08
145 0.08
146 0.11
147 0.11
148 0.11
149 0.1
150 0.1
151 0.1
152 0.1
153 0.11
154 0.08
155 0.08
156 0.11
157 0.17
158 0.18
159 0.18
160 0.19
161 0.21
162 0.23
163 0.23
164 0.2
165 0.21
166 0.2
167 0.22
168 0.23
169 0.22
170 0.19
171 0.2
172 0.2
173 0.13
174 0.18
175 0.19
176 0.17
177 0.16
178 0.2
179 0.21
180 0.21
181 0.23
182 0.22
183 0.22
184 0.23
185 0.25
186 0.24
187 0.24
188 0.25
189 0.27
190 0.29
191 0.34
192 0.36
193 0.35
194 0.38
195 0.37
196 0.37
197 0.35
198 0.34
199 0.31
200 0.32
201 0.32
202 0.29
203 0.29
204 0.31
205 0.34
206 0.34
207 0.38
208 0.36
209 0.36
210 0.35
211 0.41
212 0.45
213 0.42
214 0.41
215 0.41
216 0.4
217 0.43
218 0.51
219 0.55
220 0.57
221 0.63
222 0.68
223 0.71
224 0.8
225 0.85
226 0.84
227 0.84
228 0.85
229 0.88
230 0.88
231 0.85
232 0.83
233 0.8
234 0.79
235 0.69
236 0.62
237 0.54
238 0.44
239 0.4
240 0.33
241 0.32
242 0.24
243 0.31
244 0.31
245 0.34
246 0.35
247 0.31
248 0.34
249 0.3
250 0.31
251 0.29
252 0.28
253 0.23
254 0.24
255 0.24
256 0.23
257 0.26
258 0.23
259 0.25
260 0.22
261 0.25
262 0.25
263 0.26
264 0.26
265 0.22
266 0.24
267 0.2
268 0.24
269 0.19
270 0.22
271 0.2
272 0.19
273 0.19
274 0.17
275 0.17
276 0.13
277 0.14
278 0.13
279 0.15
280 0.15
281 0.14
282 0.14
283 0.14
284 0.14
285 0.13
286 0.15
287 0.13
288 0.13
289 0.14
290 0.14
291 0.16
292 0.21
293 0.26
294 0.23
295 0.24
296 0.24
297 0.24
298 0.28
299 0.25
300 0.21
301 0.17
302 0.17
303 0.15
304 0.16
305 0.15
306 0.11
307 0.11
308 0.1
309 0.14
310 0.13
311 0.14
312 0.15
313 0.17
314 0.18
315 0.23
316 0.29
317 0.27
318 0.27
319 0.26
320 0.25
321 0.24
322 0.24
323 0.2
324 0.16
325 0.14
326 0.16
327 0.15
328 0.13
329 0.13
330 0.12
331 0.13
332 0.11
333 0.11
334 0.1
335 0.11
336 0.13
337 0.13
338 0.13
339 0.13
340 0.13
341 0.14
342 0.15
343 0.15
344 0.16
345 0.15
346 0.14