Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2I5S4

Protein Details
Accession A0A1X2I5S4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
14-34QVSCVRFKKRCRESKRLAVVFHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 15, mito 5, pero 2, E.R. 2, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MELSHLNCILCIFQVSCVRFKKRCRESKRLAVVFRGNQWVTISWEKKRPDQIWIFFYVFCLPSTVSVFLMPCS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.22
3 0.28
4 0.33
5 0.4
6 0.44
7 0.51
8 0.57
9 0.61
10 0.7
11 0.73
12 0.76
13 0.78
14 0.82
15 0.85
16 0.8
17 0.71
18 0.65
19 0.61
20 0.52
21 0.46
22 0.4
23 0.3
24 0.25
25 0.24
26 0.2
27 0.2
28 0.25
29 0.25
30 0.23
31 0.31
32 0.33
33 0.37
34 0.44
35 0.41
36 0.43
37 0.48
38 0.5
39 0.46
40 0.49
41 0.45
42 0.37
43 0.37
44 0.31
45 0.24
46 0.19
47 0.17
48 0.13
49 0.14
50 0.17
51 0.17
52 0.15
53 0.16