Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2IAW3

Protein Details
Accession A0A1X2IAW3    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
40-68DMIVTIKKKNPCRRKKKIRRPLNLLLLLPHydrophilic
NLS Segment(s)
PositionSequence
46-59KKKNPCRRKKKIRR
Subcellular Location(s) nucl 7mito 7mito_nucl 7, cyto 5, plas 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MYKWEIIFIMRAMYNVCICMPVYLYKKYEKCRIFKYTMLDMIVTIKKKNPCRRKKKIRRPLNLLLLLPFGSFSPPLLHTVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.12
4 0.1
5 0.1
6 0.1
7 0.11
8 0.15
9 0.18
10 0.21
11 0.24
12 0.3
13 0.35
14 0.4
15 0.48
16 0.47
17 0.49
18 0.52
19 0.57
20 0.53
21 0.51
22 0.51
23 0.46
24 0.42
25 0.37
26 0.3
27 0.23
28 0.22
29 0.22
30 0.17
31 0.14
32 0.17
33 0.23
34 0.32
35 0.42
36 0.5
37 0.58
38 0.68
39 0.79
40 0.86
41 0.91
42 0.94
43 0.94
44 0.94
45 0.94
46 0.92
47 0.9
48 0.88
49 0.81
50 0.7
51 0.61
52 0.51
53 0.41
54 0.32
55 0.23
56 0.13
57 0.1
58 0.1
59 0.09
60 0.11
61 0.12