Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2IAW4

Protein Details
Accession A0A1X2IAW4    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
32-75WDKAKEAYKKRQDPQNKKTTPFSTEKRYKHKQRIEKRTSLKRKTHydrophilic
NLS Segment(s)
PositionSequence
55-79TEKRYKHKQRIEKRTSLKRKTPSPT
Subcellular Location(s) nucl 12, cyto 6, mito 4, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR047313  SMN_C  
IPR010304  SMN_Tudor  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0097504  C:Gemini of coiled bodies  
GO:0003723  F:RNA binding  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF06003  SMN  
CDD cd22852  SMN_C  
Amino Acid Sequences MNGEDPYIGQVIYNTGGGKGDAWDDSELIDFWDKAKEAYKKRQDPQNKKTTPFSTEKRYKHKQRIEKRTSLKRKTPSPTLPPKTPIPPRSPPTPQTNDNDSFTHMIMAWYYAGYYTGLYIGGSNSAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.1
4 0.1
5 0.1
6 0.09
7 0.09
8 0.08
9 0.1
10 0.11
11 0.1
12 0.1
13 0.11
14 0.1
15 0.1
16 0.11
17 0.08
18 0.09
19 0.11
20 0.11
21 0.11
22 0.18
23 0.25
24 0.31
25 0.41
26 0.51
27 0.57
28 0.63
29 0.72
30 0.76
31 0.78
32 0.81
33 0.82
34 0.76
35 0.7
36 0.71
37 0.64
38 0.59
39 0.55
40 0.5
41 0.49
42 0.53
43 0.56
44 0.58
45 0.65
46 0.69
47 0.72
48 0.76
49 0.77
50 0.78
51 0.83
52 0.82
53 0.81
54 0.8
55 0.81
56 0.83
57 0.8
58 0.77
59 0.72
60 0.73
61 0.7
62 0.7
63 0.66
64 0.65
65 0.69
66 0.67
67 0.64
68 0.6
69 0.59
70 0.58
71 0.59
72 0.56
73 0.52
74 0.54
75 0.54
76 0.58
77 0.6
78 0.57
79 0.58
80 0.58
81 0.56
82 0.54
83 0.57
84 0.53
85 0.5
86 0.45
87 0.39
88 0.34
89 0.3
90 0.24
91 0.18
92 0.14
93 0.11
94 0.11
95 0.09
96 0.07
97 0.07
98 0.06
99 0.07
100 0.07
101 0.07
102 0.06
103 0.06
104 0.06
105 0.07
106 0.07
107 0.07