Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2HX36

Protein Details
Accession A0A1X2HX36    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
4-31DKLTAHKEPEKVRKKPKLKRFALPHTTNBasic
NLS Segment(s)
PositionSequence
11-23EPEKVRKKPKLKR
Subcellular Location(s) nucl 18.5, cyto_nucl 13.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MPLDKLTAHKEPEKVRKKPKLKRFALPHTTNSVAVQSMPNLDCQVLFHQFLCALIKSGLLGVSQTDSSMYCILCLILS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.71
3 0.77
4 0.83
5 0.86
6 0.88
7 0.88
8 0.84
9 0.85
10 0.83
11 0.83
12 0.82
13 0.76
14 0.69
15 0.63
16 0.59
17 0.49
18 0.4
19 0.3
20 0.2
21 0.16
22 0.13
23 0.08
24 0.09
25 0.09
26 0.09
27 0.08
28 0.08
29 0.07
30 0.08
31 0.11
32 0.11
33 0.11
34 0.11
35 0.11
36 0.11
37 0.12
38 0.13
39 0.1
40 0.1
41 0.09
42 0.09
43 0.09
44 0.09
45 0.09
46 0.07
47 0.07
48 0.06
49 0.08
50 0.08
51 0.08
52 0.08
53 0.08
54 0.1
55 0.12
56 0.11
57 0.1
58 0.1