Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2J1Y0

Protein Details
Accession A0A1X2J1Y0    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-50MVPKKYKSKRGTAREYYKIEKRVREHHRKLRKEQKKNPQLRRKPKDPGIPBasic
78-101RAARLAQSEKDKKNKPHQKKAKSGBasic
NLS Segment(s)
PositionSequence
4-46KKYKSKRGTAREYYKIEKRVREHHRKLRKEQKKNPQLRRKPKD
74-101KKKQRAARLAQSEKDKKNKPHQKKAKSG
Subcellular Location(s) nucl 20, cyto_nucl 12.5, mito 3, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR014813  Gnl3_N_dom  
Pfam View protein in Pfam  
PF08701  GN3L_Grn1  
Amino Acid Sequences MVPKKYKSKRGTAREYYKIEKRVREHHRKLRKEQKKNPQLRRKPKDPGIPNNWPFKEELLNEVERHKLDLEEEKKKQRAARLAQSEKDKKNKPHQKKAKSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.82
3 0.78
4 0.75
5 0.74
6 0.69
7 0.66
8 0.62
9 0.64
10 0.68
11 0.72
12 0.75
13 0.77
14 0.82
15 0.82
16 0.87
17 0.88
18 0.88
19 0.88
20 0.88
21 0.89
22 0.89
23 0.91
24 0.91
25 0.91
26 0.91
27 0.91
28 0.9
29 0.86
30 0.84
31 0.81
32 0.79
33 0.76
34 0.74
35 0.71
36 0.72
37 0.68
38 0.68
39 0.6
40 0.52
41 0.44
42 0.36
43 0.32
44 0.23
45 0.22
46 0.18
47 0.19
48 0.19
49 0.2
50 0.21
51 0.17
52 0.18
53 0.15
54 0.12
55 0.12
56 0.21
57 0.26
58 0.33
59 0.39
60 0.46
61 0.48
62 0.52
63 0.54
64 0.52
65 0.55
66 0.54
67 0.59
68 0.61
69 0.65
70 0.67
71 0.73
72 0.75
73 0.73
74 0.75
75 0.73
76 0.72
77 0.77
78 0.82
79 0.83
80 0.85
81 0.89