Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8PII4

Protein Details
Accession B8PII4   
Localization Confidence Low
Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
101-127PGGKAEKYMLRKQNRRKIRDQNFMKTQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG ppl:POSPLDRAFT_129182  -  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MSLLHTLRRPPVFNAWYPARRCFASSSKTADAALAAPAIASEAKKVDGAEAVSRSSCPEGTILTGMSYLKNQQPVTAMADDAYPEWLWKLLEPKQLPDDGPGGKAEKYMLRKQNRRKIRDQNFMKTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.5
3 0.53
4 0.54
5 0.54
6 0.47
7 0.43
8 0.42
9 0.4
10 0.39
11 0.36
12 0.37
13 0.4
14 0.38
15 0.38
16 0.36
17 0.3
18 0.24
19 0.2
20 0.16
21 0.09
22 0.06
23 0.05
24 0.05
25 0.05
26 0.05
27 0.05
28 0.05
29 0.06
30 0.07
31 0.08
32 0.08
33 0.07
34 0.08
35 0.09
36 0.11
37 0.11
38 0.11
39 0.11
40 0.11
41 0.11
42 0.11
43 0.1
44 0.08
45 0.07
46 0.07
47 0.08
48 0.08
49 0.07
50 0.06
51 0.07
52 0.07
53 0.06
54 0.06
55 0.08
56 0.09
57 0.14
58 0.13
59 0.14
60 0.15
61 0.16
62 0.2
63 0.18
64 0.16
65 0.12
66 0.12
67 0.11
68 0.1
69 0.1
70 0.06
71 0.06
72 0.06
73 0.07
74 0.07
75 0.08
76 0.14
77 0.17
78 0.26
79 0.27
80 0.3
81 0.32
82 0.34
83 0.33
84 0.3
85 0.29
86 0.22
87 0.22
88 0.2
89 0.19
90 0.17
91 0.18
92 0.17
93 0.19
94 0.25
95 0.33
96 0.4
97 0.49
98 0.59
99 0.69
100 0.78
101 0.82
102 0.83
103 0.84
104 0.86
105 0.86
106 0.87
107 0.85