Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2IB31

Protein Details
Accession A0A1X2IB31    Localization Confidence Low Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
69-95FKPYICLKCRKTFKRPQDLKKHEKTHTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5cyto_nucl 10.5, mito 8, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MPKYSFTCHWKECNELYDNVETLFEHLSDDHVGRRSTNNLCLTCYWNECGATAAKRDHLTSHLKIHLPFKPYICLKCRKTFKRPQDLKKHEKTHTIEHQGKSLIDEMK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.42
3 0.4
4 0.36
5 0.33
6 0.27
7 0.24
8 0.17
9 0.15
10 0.14
11 0.1
12 0.08
13 0.08
14 0.09
15 0.1
16 0.11
17 0.12
18 0.15
19 0.15
20 0.16
21 0.18
22 0.21
23 0.23
24 0.29
25 0.32
26 0.29
27 0.3
28 0.31
29 0.32
30 0.29
31 0.28
32 0.23
33 0.18
34 0.18
35 0.16
36 0.16
37 0.14
38 0.12
39 0.13
40 0.12
41 0.13
42 0.14
43 0.14
44 0.14
45 0.16
46 0.21
47 0.21
48 0.25
49 0.27
50 0.28
51 0.29
52 0.33
53 0.33
54 0.31
55 0.31
56 0.28
57 0.3
58 0.32
59 0.36
60 0.38
61 0.43
62 0.45
63 0.52
64 0.61
65 0.63
66 0.69
67 0.74
68 0.79
69 0.81
70 0.85
71 0.86
72 0.87
73 0.9
74 0.9
75 0.89
76 0.87
77 0.8
78 0.79
79 0.74
80 0.72
81 0.72
82 0.72
83 0.69
84 0.62
85 0.62
86 0.56
87 0.51
88 0.44