Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2IHK2

Protein Details
Accession A0A1X2IHK2   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
90-115MELIKNSKDKRAKKLTKKRLGTFLRSHydrophilic
NLS Segment(s)
PositionSequence
95-118NSKDKRAKKLTKKRLGTFLRSKKK
Subcellular Location(s) mito 13, nucl 9.5, cyto_nucl 7, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
PROSITE View protein in PROSITE  
PS01190  RIBOSOMAL_L36E  
Amino Acid Sequences MSVVWREGGFTFVDEIRIFWISSFLNLLSPQMAPQQKSGIAVGLNKGHITTRRELKQKPSTRQGASKRTTFVRNIVREVAGFAPYERRVMELIKNSKDKRAKKLTKKRLGTFLRSKKKIDELTNVIALSRRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.14
4 0.15
5 0.14
6 0.11
7 0.14
8 0.12
9 0.12
10 0.14
11 0.11
12 0.12
13 0.12
14 0.12
15 0.1
16 0.1
17 0.1
18 0.16
19 0.19
20 0.19
21 0.2
22 0.22
23 0.22
24 0.23
25 0.22
26 0.16
27 0.14
28 0.14
29 0.15
30 0.14
31 0.14
32 0.12
33 0.12
34 0.12
35 0.16
36 0.19
37 0.22
38 0.28
39 0.34
40 0.4
41 0.42
42 0.5
43 0.56
44 0.6
45 0.62
46 0.63
47 0.62
48 0.59
49 0.65
50 0.63
51 0.62
52 0.57
53 0.52
54 0.46
55 0.43
56 0.43
57 0.36
58 0.35
59 0.35
60 0.33
61 0.33
62 0.32
63 0.3
64 0.26
65 0.27
66 0.21
67 0.13
68 0.11
69 0.09
70 0.12
71 0.13
72 0.14
73 0.12
74 0.12
75 0.12
76 0.15
77 0.19
78 0.24
79 0.3
80 0.35
81 0.43
82 0.43
83 0.5
84 0.57
85 0.58
86 0.59
87 0.64
88 0.69
89 0.72
90 0.83
91 0.85
92 0.87
93 0.9
94 0.86
95 0.85
96 0.81
97 0.79
98 0.79
99 0.79
100 0.79
101 0.75
102 0.72
103 0.67
104 0.69
105 0.68
106 0.63
107 0.61
108 0.57
109 0.58
110 0.58
111 0.52
112 0.44