Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2I047

Protein Details
Accession A0A1X2I047   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
33-65SPSAKDKKPLKIRRTAKRNRTEKQEKPLKKSLCHydrophilic
NLS Segment(s)
PositionSequence
36-62AKDKKPLKIRRTAKRNRTEKQEKPLKK
Subcellular Location(s) mito 15, nucl 9, extr 2
Family & Domain DBs
Amino Acid Sequences MSAILVPLAPTSLPTSSTVALPPSSLSVAPPHSPSAKDKKPLKIRRTAKRNRTEKQEKPLKKSLCLAPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.15
3 0.15
4 0.16
5 0.16
6 0.15
7 0.14
8 0.13
9 0.11
10 0.1
11 0.1
12 0.09
13 0.09
14 0.1
15 0.12
16 0.13
17 0.14
18 0.15
19 0.15
20 0.17
21 0.2
22 0.27
23 0.29
24 0.37
25 0.41
26 0.49
27 0.58
28 0.67
29 0.68
30 0.7
31 0.75
32 0.77
33 0.82
34 0.83
35 0.82
36 0.83
37 0.87
38 0.83
39 0.84
40 0.84
41 0.81
42 0.82
43 0.82
44 0.79
45 0.78
46 0.81
47 0.75
48 0.69
49 0.69