Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2HBD2

Protein Details
Accession A0A1X2HBD2    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
38-62DVRYSIPRSGRRQRHWCHRGFRLRTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, cyto_nucl 10.333, cyto 7.5, mito 7, cyto_pero 4.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR029045  ClpP/crotonase-like_dom_sf  
Amino Acid Sequences MTKYQYETVTVTIIDKVAHVQMNRPKKLNSFNPALIRDVRYSIPRSGRRQRHWCHRGFRLRTYVYRWFGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.1
4 0.11
5 0.14
6 0.13
7 0.19
8 0.26
9 0.36
10 0.39
11 0.4
12 0.39
13 0.41
14 0.49
15 0.49
16 0.47
17 0.42
18 0.44
19 0.45
20 0.45
21 0.42
22 0.35
23 0.3
24 0.25
25 0.22
26 0.19
27 0.18
28 0.2
29 0.22
30 0.3
31 0.35
32 0.43
33 0.51
34 0.59
35 0.66
36 0.73
37 0.77
38 0.8
39 0.82
40 0.81
41 0.79
42 0.8
43 0.81
44 0.77
45 0.75
46 0.73
47 0.7
48 0.67
49 0.66
50 0.65