Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2J1D3

Protein Details
Accession A0A1X2J1D3    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
4-28DKSTAHKEPEKVRKRAKLKRFALPHBasic
NLS Segment(s)
PositionSequence
11-23EPEKVRKRAKLKR
Subcellular Location(s) mito 13.5, mito_nucl 12.5, nucl 10.5
Family & Domain DBs
Amino Acid Sequences MPLDKSTAHKEPEKVRKRAKLKRFALPHTTNSVAVPPMPNLDCQVLFHQFLFALIKSGLLGVSQTDSSMYCIFCLILS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.7
3 0.75
4 0.8
5 0.84
6 0.84
7 0.84
8 0.8
9 0.8
10 0.78
11 0.74
12 0.73
13 0.68
14 0.61
15 0.55
16 0.51
17 0.42
18 0.35
19 0.3
20 0.21
21 0.17
22 0.14
23 0.09
24 0.1
25 0.1
26 0.1
27 0.1
28 0.11
29 0.1
30 0.11
31 0.13
32 0.14
33 0.14
34 0.14
35 0.13
36 0.11
37 0.12
38 0.12
39 0.09
40 0.09
41 0.08
42 0.08
43 0.08
44 0.08
45 0.07
46 0.06
47 0.06
48 0.05
49 0.07
50 0.07
51 0.07
52 0.07
53 0.08
54 0.11
55 0.13
56 0.13
57 0.11
58 0.11