Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2ICN4

Protein Details
Accession A0A1X2ICN4    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-22KKAKKKWSAKKVKDKANNMVVLHydrophilic
NLS Segment(s)
PositionSequence
2-13KAKKKWSAKKVK
Subcellular Location(s) mito 17, nucl 5, cyto_nucl 5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences KKAKKKWSAKKVKDKANNMVVLDKPTYERLFKEVPTYKLISQSVLVDRLKLNGSLARVALKELTAQGLIKPLTIHHAQVIYSKC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.85
3 0.82
4 0.75
5 0.64
6 0.59
7 0.49
8 0.43
9 0.36
10 0.27
11 0.21
12 0.21
13 0.22
14 0.19
15 0.19
16 0.2
17 0.22
18 0.22
19 0.28
20 0.3
21 0.3
22 0.32
23 0.34
24 0.3
25 0.32
26 0.32
27 0.24
28 0.19
29 0.19
30 0.16
31 0.18
32 0.17
33 0.14
34 0.13
35 0.14
36 0.15
37 0.13
38 0.13
39 0.11
40 0.12
41 0.12
42 0.12
43 0.12
44 0.12
45 0.12
46 0.12
47 0.1
48 0.1
49 0.09
50 0.1
51 0.09
52 0.1
53 0.09
54 0.14
55 0.14
56 0.13
57 0.13
58 0.12
59 0.17
60 0.18
61 0.19
62 0.17
63 0.18
64 0.18