Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8PFB3

Protein Details
Accession B8PFB3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
357-379RTATGGKKTKVKKKVAFMSDRPDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, extr 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR008728  Elongator_complex_protein_4  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0033588  C:elongator holoenzyme complex  
GO:0005634  C:nucleus  
GO:0002098  P:tRNA wobble uridine modification  
KEGG ppl:POSPLDRAFT_89608  -  
Pfam View protein in Pfam  
PF05625  PAXNEB  
CDD cd19494  Elp4  
Amino Acid Sequences MSSFKRRASSTQPPPPSGTRISPGSSSTITTSTGIPSLDDILGGGLPLSCSLLVLAPDTHSAYGELVQKYFISQGLASGHKLCVVDDDARDILAECMWVPGGAPSASTNAAEDEEDDKAAQHDTKIKIAWRYEQMKQFQTTVPTSNQSSEDYCRVFDLTCRIPDTTVQSAIKAGQLARHHGATSCPRLVPSPVDPEPNAYHGHNRKFVTFSSRFVGYCAAIPTPVHPSHYPLACALMHGVGRAGSKSWAGSPTPASLSQHSPRPLLDAARALGLGREQPRVQTLHLDLEGGVGERRTTPSANAIALDDVAPVRSHVYGHADGDQTAAPTARAAVHVEIEQASATTAALSITDVPSERTATGGKKTKVKKKVAFMSDRPDLYDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.67
3 0.64
4 0.58
5 0.52
6 0.47
7 0.43
8 0.43
9 0.39
10 0.37
11 0.35
12 0.31
13 0.28
14 0.25
15 0.23
16 0.21
17 0.21
18 0.2
19 0.17
20 0.18
21 0.16
22 0.14
23 0.13
24 0.14
25 0.13
26 0.12
27 0.1
28 0.09
29 0.09
30 0.08
31 0.07
32 0.05
33 0.05
34 0.05
35 0.06
36 0.05
37 0.05
38 0.06
39 0.07
40 0.07
41 0.09
42 0.09
43 0.1
44 0.12
45 0.13
46 0.13
47 0.12
48 0.12
49 0.11
50 0.14
51 0.2
52 0.19
53 0.18
54 0.19
55 0.18
56 0.18
57 0.19
58 0.15
59 0.11
60 0.1
61 0.12
62 0.15
63 0.17
64 0.17
65 0.18
66 0.17
67 0.18
68 0.18
69 0.15
70 0.15
71 0.16
72 0.18
73 0.16
74 0.2
75 0.17
76 0.17
77 0.17
78 0.15
79 0.12
80 0.09
81 0.09
82 0.05
83 0.06
84 0.06
85 0.06
86 0.05
87 0.05
88 0.07
89 0.07
90 0.07
91 0.08
92 0.1
93 0.11
94 0.1
95 0.1
96 0.09
97 0.1
98 0.09
99 0.1
100 0.1
101 0.1
102 0.1
103 0.1
104 0.09
105 0.09
106 0.1
107 0.1
108 0.09
109 0.16
110 0.17
111 0.2
112 0.22
113 0.25
114 0.28
115 0.3
116 0.33
117 0.34
118 0.38
119 0.41
120 0.46
121 0.47
122 0.47
123 0.46
124 0.43
125 0.37
126 0.36
127 0.32
128 0.28
129 0.26
130 0.24
131 0.24
132 0.23
133 0.23
134 0.2
135 0.2
136 0.2
137 0.22
138 0.19
139 0.18
140 0.17
141 0.16
142 0.15
143 0.14
144 0.17
145 0.16
146 0.18
147 0.19
148 0.19
149 0.19
150 0.2
151 0.24
152 0.21
153 0.22
154 0.2
155 0.18
156 0.19
157 0.19
158 0.18
159 0.14
160 0.11
161 0.11
162 0.12
163 0.16
164 0.17
165 0.17
166 0.16
167 0.16
168 0.19
169 0.19
170 0.22
171 0.2
172 0.19
173 0.19
174 0.19
175 0.2
176 0.19
177 0.17
178 0.2
179 0.2
180 0.22
181 0.21
182 0.24
183 0.23
184 0.23
185 0.22
186 0.16
187 0.22
188 0.26
189 0.3
190 0.33
191 0.33
192 0.32
193 0.32
194 0.32
195 0.33
196 0.29
197 0.27
198 0.24
199 0.25
200 0.23
201 0.22
202 0.23
203 0.14
204 0.14
205 0.13
206 0.11
207 0.1
208 0.1
209 0.1
210 0.15
211 0.15
212 0.16
213 0.15
214 0.19
215 0.23
216 0.24
217 0.24
218 0.18
219 0.2
220 0.17
221 0.17
222 0.13
223 0.1
224 0.09
225 0.09
226 0.09
227 0.07
228 0.08
229 0.08
230 0.08
231 0.07
232 0.08
233 0.08
234 0.09
235 0.11
236 0.11
237 0.13
238 0.14
239 0.15
240 0.17
241 0.18
242 0.18
243 0.18
244 0.24
245 0.25
246 0.3
247 0.3
248 0.29
249 0.28
250 0.3
251 0.29
252 0.24
253 0.23
254 0.19
255 0.18
256 0.17
257 0.17
258 0.13
259 0.12
260 0.11
261 0.13
262 0.13
263 0.16
264 0.16
265 0.17
266 0.21
267 0.22
268 0.22
269 0.22
270 0.22
271 0.23
272 0.23
273 0.22
274 0.19
275 0.17
276 0.17
277 0.12
278 0.11
279 0.06
280 0.07
281 0.08
282 0.1
283 0.12
284 0.13
285 0.13
286 0.18
287 0.21
288 0.21
289 0.2
290 0.19
291 0.17
292 0.16
293 0.15
294 0.1
295 0.08
296 0.08
297 0.07
298 0.07
299 0.08
300 0.08
301 0.08
302 0.1
303 0.16
304 0.17
305 0.19
306 0.22
307 0.22
308 0.21
309 0.22
310 0.21
311 0.15
312 0.14
313 0.13
314 0.09
315 0.08
316 0.09
317 0.09
318 0.1
319 0.11
320 0.12
321 0.13
322 0.14
323 0.15
324 0.14
325 0.14
326 0.12
327 0.1
328 0.09
329 0.07
330 0.07
331 0.05
332 0.05
333 0.05
334 0.05
335 0.06
336 0.07
337 0.08
338 0.09
339 0.1
340 0.12
341 0.14
342 0.16
343 0.15
344 0.15
345 0.19
346 0.21
347 0.3
348 0.37
349 0.4
350 0.47
351 0.57
352 0.65
353 0.71
354 0.78
355 0.77
356 0.78
357 0.84
358 0.85
359 0.85
360 0.81
361 0.79
362 0.76
363 0.69