Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2I6W4

Protein Details
Accession A0A1X2I6W4    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MDGPKKNVTSSRRKCRKAHFSAPSHIRQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, mito_nucl 12.833, cyto_nucl 11.333, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005824  KOW  
IPR041988  KOW_RPL26/RPL24  
IPR014722  Rib_L2_dom2  
IPR005825  Ribosomal_L24/26_CS  
IPR005756  Ribosomal_L26/L24P_euk/arc  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00467  KOW  
PF16906  Ribosomal_L26  
PROSITE View protein in PROSITE  
PS01108  RIBOSOMAL_L24  
CDD cd06089  KOW_RPL26  
Amino Acid Sequences MDGPKKNVTSSRRKCRKAHFSAPSHIRQKIMSSPLSKELKEKHSVSRAMPIRRDDEVTVVRGTYKGREGKVVQVYRKKWVIYIERVTREKVNGATAPIGIHPSNVVINKLKLDHSRQSVLDRKGNKDAMQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.84
3 0.87
4 0.85
5 0.85
6 0.83
7 0.79
8 0.81
9 0.8
10 0.78
11 0.73
12 0.65
13 0.56
14 0.47
15 0.44
16 0.41
17 0.39
18 0.35
19 0.32
20 0.33
21 0.4
22 0.42
23 0.39
24 0.37
25 0.38
26 0.39
27 0.43
28 0.42
29 0.4
30 0.44
31 0.46
32 0.42
33 0.45
34 0.46
35 0.44
36 0.46
37 0.42
38 0.38
39 0.37
40 0.38
41 0.29
42 0.27
43 0.23
44 0.21
45 0.19
46 0.15
47 0.14
48 0.13
49 0.13
50 0.1
51 0.14
52 0.16
53 0.16
54 0.2
55 0.2
56 0.26
57 0.33
58 0.36
59 0.37
60 0.41
61 0.42
62 0.43
63 0.45
64 0.39
65 0.33
66 0.35
67 0.36
68 0.36
69 0.42
70 0.44
71 0.47
72 0.49
73 0.49
74 0.44
75 0.39
76 0.35
77 0.28
78 0.25
79 0.2
80 0.2
81 0.18
82 0.17
83 0.16
84 0.14
85 0.16
86 0.12
87 0.11
88 0.1
89 0.1
90 0.13
91 0.14
92 0.16
93 0.16
94 0.18
95 0.2
96 0.21
97 0.25
98 0.27
99 0.32
100 0.37
101 0.4
102 0.43
103 0.43
104 0.49
105 0.53
106 0.54
107 0.55
108 0.53
109 0.53
110 0.57
111 0.59