Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2I3S5

Protein Details
Accession A0A1X2I3S5    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-28AKDTKKDTKVSAKRQKKDPNAPKRGLSHydrophilic
NLS Segment(s)
PositionSequence
13-21AKRQKKDPN
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MAKDTKKDTKVSAKRQKKDPNAPKRGLSAYMFFSQANRNKVKEENPDATFGQLGKILGQKWKEMSDEEKKPYHHQAEKDKARYEAEKAKTVSHDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.84
3 0.88
4 0.87
5 0.88
6 0.88
7 0.88
8 0.87
9 0.83
10 0.75
11 0.69
12 0.61
13 0.53
14 0.44
15 0.36
16 0.3
17 0.27
18 0.26
19 0.21
20 0.2
21 0.24
22 0.27
23 0.31
24 0.3
25 0.29
26 0.31
27 0.34
28 0.38
29 0.38
30 0.39
31 0.38
32 0.36
33 0.38
34 0.36
35 0.33
36 0.28
37 0.2
38 0.15
39 0.1
40 0.09
41 0.07
42 0.09
43 0.1
44 0.14
45 0.15
46 0.16
47 0.16
48 0.18
49 0.18
50 0.18
51 0.24
52 0.29
53 0.35
54 0.38
55 0.4
56 0.41
57 0.45
58 0.51
59 0.53
60 0.51
61 0.52
62 0.58
63 0.64
64 0.71
65 0.73
66 0.67
67 0.61
68 0.6
69 0.55
70 0.52
71 0.5
72 0.46
73 0.47
74 0.45
75 0.47