Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2I119

Protein Details
Accession A0A1X2I119    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
42-61VFACKKCKKAFRKNVLDYEEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 6.5, cyto_nucl 5.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008913  Znf_CHY  
IPR037274  Znf_CHY_sf  
Gene Ontology GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF05495  zf-CHY  
PROSITE View protein in PROSITE  
PS51266  ZF_CHY  
Amino Acid Sequences MCKHILNAQASIRAPCCRRWFDCAECHQEVSDHPLRKTDEMVFACKKCKKAFRKNVLDYEEEDEYCPHCDNHYVLEALMPEAQLGIETGDLRKDARVIKDARTKLKTDPTSIFDIDFSDHVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.36
3 0.41
4 0.43
5 0.44
6 0.48
7 0.53
8 0.52
9 0.58
10 0.58
11 0.58
12 0.53
13 0.51
14 0.44
15 0.38
16 0.32
17 0.32
18 0.32
19 0.28
20 0.26
21 0.31
22 0.32
23 0.33
24 0.35
25 0.29
26 0.29
27 0.27
28 0.33
29 0.32
30 0.32
31 0.37
32 0.38
33 0.4
34 0.37
35 0.45
36 0.5
37 0.56
38 0.66
39 0.7
40 0.77
41 0.78
42 0.8
43 0.74
44 0.65
45 0.55
46 0.47
47 0.38
48 0.27
49 0.22
50 0.15
51 0.13
52 0.13
53 0.12
54 0.08
55 0.08
56 0.09
57 0.1
58 0.11
59 0.12
60 0.11
61 0.1
62 0.11
63 0.11
64 0.1
65 0.1
66 0.08
67 0.06
68 0.05
69 0.05
70 0.04
71 0.04
72 0.04
73 0.04
74 0.05
75 0.05
76 0.06
77 0.07
78 0.07
79 0.08
80 0.11
81 0.14
82 0.18
83 0.25
84 0.26
85 0.34
86 0.43
87 0.48
88 0.54
89 0.53
90 0.53
91 0.52
92 0.6
93 0.55
94 0.52
95 0.51
96 0.47
97 0.48
98 0.46
99 0.41
100 0.31
101 0.28
102 0.24