Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2IRA6

Protein Details
Accession A0A1X2IRA6   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
150-174NDDHPTKTSDKKKQPINKKKKKVNDBasic
NLS Segment(s)
PositionSequence
160-171KKKQPINKKKKK
Subcellular Location(s) plas 12, E.R. 6, mito 5, golg 3, cyto_mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR008417  BAP29/BAP31  
IPR040463  BAP29/BAP31_N  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0006888  P:endoplasmic reticulum to Golgi vesicle-mediated transport  
GO:0006886  P:intracellular protein transport  
GO:0070973  P:protein localization to endoplasmic reticulum exit site  
Pfam View protein in Pfam  
PF05529  Bap31  
Amino Acid Sequences MTLYYSLIFVILVIEILLFFVLMLPLPIKWQKILIHWWSTSPTVSRIKYFTKISCVFIFILLLDSIARIDIGKEAKNIMNTDEEESNVSAPPSHDMEATMFARKFYAQRNIYLCGSTLFLDLILRRIFFLLKEKIVLTDKIFELQQSLANDDHPTKTSDKKKQPINKKKKKVND
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.04
5 0.03
6 0.03
7 0.03
8 0.03
9 0.03
10 0.04
11 0.05
12 0.05
13 0.09
14 0.13
15 0.14
16 0.14
17 0.19
18 0.21
19 0.25
20 0.33
21 0.34
22 0.36
23 0.35
24 0.36
25 0.34
26 0.33
27 0.31
28 0.24
29 0.24
30 0.26
31 0.27
32 0.28
33 0.29
34 0.31
35 0.35
36 0.38
37 0.35
38 0.36
39 0.37
40 0.38
41 0.35
42 0.33
43 0.28
44 0.24
45 0.22
46 0.13
47 0.12
48 0.08
49 0.08
50 0.05
51 0.05
52 0.05
53 0.05
54 0.05
55 0.03
56 0.03
57 0.06
58 0.08
59 0.09
60 0.1
61 0.12
62 0.14
63 0.16
64 0.16
65 0.14
66 0.14
67 0.14
68 0.16
69 0.14
70 0.13
71 0.12
72 0.12
73 0.11
74 0.09
75 0.08
76 0.06
77 0.06
78 0.08
79 0.09
80 0.09
81 0.08
82 0.09
83 0.1
84 0.13
85 0.13
86 0.15
87 0.13
88 0.13
89 0.13
90 0.14
91 0.15
92 0.17
93 0.26
94 0.24
95 0.28
96 0.31
97 0.35
98 0.34
99 0.33
100 0.28
101 0.19
102 0.19
103 0.14
104 0.12
105 0.08
106 0.07
107 0.08
108 0.08
109 0.11
110 0.1
111 0.1
112 0.1
113 0.1
114 0.11
115 0.11
116 0.18
117 0.19
118 0.19
119 0.2
120 0.2
121 0.23
122 0.26
123 0.27
124 0.21
125 0.22
126 0.21
127 0.22
128 0.22
129 0.18
130 0.17
131 0.16
132 0.19
133 0.15
134 0.17
135 0.16
136 0.17
137 0.19
138 0.2
139 0.21
140 0.18
141 0.2
142 0.21
143 0.3
144 0.39
145 0.47
146 0.56
147 0.62
148 0.71
149 0.78
150 0.86
151 0.88
152 0.89
153 0.9
154 0.91