Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2IMY2

Protein Details
Accession A0A1X2IMY2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
46-65IWDKVNKGKQWKDIKHNYEKHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 8, mito 6, extr 6, golg 4, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR008027  QCR9  
IPR036656  QCR9_sf  
Gene Ontology GO:0005750  C:mitochondrial respiratory chain complex III  
GO:0006122  P:mitochondrial electron transport, ubiquinol to cytochrome c  
Pfam View protein in Pfam  
PF05365  UCR_UQCRX_QCR9  
Amino Acid Sequences MPAAASSGIARGVYNTLFKKNSVFITSIFVSAIAFEVVYDTASTTIWDKVNKGKQWKDIKHNYEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.21
4 0.22
5 0.23
6 0.24
7 0.25
8 0.26
9 0.23
10 0.22
11 0.18
12 0.21
13 0.21
14 0.19
15 0.16
16 0.13
17 0.11
18 0.1
19 0.09
20 0.04
21 0.03
22 0.03
23 0.04
24 0.04
25 0.04
26 0.04
27 0.04
28 0.04
29 0.05
30 0.05
31 0.06
32 0.09
33 0.12
34 0.13
35 0.15
36 0.23
37 0.32
38 0.38
39 0.46
40 0.49
41 0.57
42 0.66
43 0.73
44 0.75
45 0.77