Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2IEL1

Protein Details
Accession A0A1X2IEL1   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MYNTCKYILYLKKRRRNMMYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 6, cyto_nucl 4.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MYNTCKYILYLKKRRRNMMYLIYAAIVVVTKKVLNSNLGRHYSHAIMYEQSLNLFSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.79
3 0.75
4 0.72
5 0.7
6 0.65
7 0.56
8 0.49
9 0.4
10 0.33
11 0.27
12 0.19
13 0.1
14 0.05
15 0.04
16 0.04
17 0.04
18 0.04
19 0.07
20 0.08
21 0.12
22 0.16
23 0.22
24 0.28
25 0.31
26 0.32
27 0.32
28 0.34
29 0.3
30 0.28
31 0.25
32 0.19
33 0.17
34 0.19
35 0.2
36 0.17
37 0.16