Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2IP06

Protein Details
Accession A0A1X2IP06   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
24-47KGGFTHRKCKVKSKGKNNYRPSSSHydrophilic
80-117QARPSKTKQDQARPSKKQARPSKKQARPSKKQARPNKTHydrophilic
NLS Segment(s)
PositionSequence
77-117KQDQARPSKTKQDQARPSKKQARPSKKQARPSKKQARPNKT
Subcellular Location(s) mito 22, nucl 4
Family & Domain DBs
Amino Acid Sequences MFRVAPLILGLSQLKIKGVLCLLKGGFTHRKCKVKSKGKNNYRPSSSLWYQENLCLLQPLLKQARNKQDQARPSKTKQDQARPSKTKQDQARPSKKQARPSKKQARPSKKQARPNKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.13
4 0.13
5 0.15
6 0.17
7 0.16
8 0.2
9 0.19
10 0.2
11 0.2
12 0.24
13 0.3
14 0.31
15 0.39
16 0.42
17 0.5
18 0.52
19 0.62
20 0.66
21 0.68
22 0.74
23 0.77
24 0.8
25 0.83
26 0.9
27 0.89
28 0.86
29 0.79
30 0.72
31 0.65
32 0.61
33 0.53
34 0.48
35 0.4
36 0.34
37 0.31
38 0.29
39 0.26
40 0.18
41 0.16
42 0.11
43 0.09
44 0.1
45 0.1
46 0.14
47 0.16
48 0.19
49 0.22
50 0.28
51 0.38
52 0.39
53 0.43
54 0.46
55 0.49
56 0.53
57 0.6
58 0.62
59 0.59
60 0.58
61 0.64
62 0.62
63 0.64
64 0.64
65 0.65
66 0.66
67 0.7
68 0.77
69 0.73
70 0.72
71 0.74
72 0.71
73 0.68
74 0.66
75 0.67
76 0.66
77 0.71
78 0.79
79 0.75
80 0.81
81 0.84
82 0.8
83 0.8
84 0.81
85 0.81
86 0.8
87 0.85
88 0.86
89 0.84
90 0.89
91 0.9
92 0.9
93 0.89
94 0.9
95 0.9
96 0.88
97 0.9