Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2J4M3

Protein Details
Accession A0A1X2J4M3    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
6-29ILDSIRHKKKPSSRMRHRPTKMAEBasic
NLS Segment(s)
PositionSequence
11-24RHKKKPSSRMRHRP
Subcellular Location(s) nucl 13, mito 12, cyto_nucl 8.5
Family & Domain DBs
Amino Acid Sequences MSRSSILDSIRHKKKPSSRMRHRPTKMAELSRTASFYIPIFGSSHSPFILSFSILFPLIKQCFPVAQLKTVLQPFYLYSLYKTKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.7
3 0.74
4 0.75
5 0.77
6 0.83
7 0.89
8 0.91
9 0.86
10 0.84
11 0.78
12 0.76
13 0.72
14 0.67
15 0.6
16 0.53
17 0.52
18 0.44
19 0.4
20 0.3
21 0.23
22 0.18
23 0.15
24 0.12
25 0.09
26 0.09
27 0.08
28 0.08
29 0.11
30 0.11
31 0.12
32 0.1
33 0.11
34 0.1
35 0.11
36 0.11
37 0.08
38 0.08
39 0.07
40 0.09
41 0.09
42 0.09
43 0.07
44 0.13
45 0.15
46 0.14
47 0.15
48 0.14
49 0.15
50 0.18
51 0.25
52 0.2
53 0.22
54 0.24
55 0.25
56 0.29
57 0.31
58 0.29
59 0.22
60 0.21
61 0.19
62 0.2
63 0.21
64 0.17
65 0.18