Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2IEG3

Protein Details
Accession A0A1X2IEG3    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
9-40LTDLRRSRSAGYRPKKKRNSSKGKNEPSRAIEHydrophilic
NLS Segment(s)
PositionSequence
14-33RSRSAGYRPKKKRNSSKGKN
Subcellular Location(s) nucl 14, mito_nucl 13.333, mito 11.5, cyto_nucl 8.333
Family & Domain DBs
Amino Acid Sequences MARPVIVELTDLRRSRSAGYRPKKKRNSSKGKNEPSRAIEAPSVTTNELPKHCESIVSHPPSTYSTTVQSHLPAYSLSDPPLPTATNSTSLVPLPSLSTPRPKRSKSTLMRIGSGLSKGHKLLARKNNSTATNDDMQMHTIGDGSNKNNTFVKRMASFGKRMKLQRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.34
3 0.4
4 0.43
5 0.46
6 0.57
7 0.64
8 0.73
9 0.82
10 0.88
11 0.9
12 0.91
13 0.92
14 0.93
15 0.92
16 0.93
17 0.93
18 0.94
19 0.93
20 0.87
21 0.83
22 0.76
23 0.71
24 0.61
25 0.52
26 0.43
27 0.34
28 0.31
29 0.26
30 0.23
31 0.17
32 0.17
33 0.17
34 0.2
35 0.2
36 0.22
37 0.21
38 0.23
39 0.22
40 0.23
41 0.22
42 0.26
43 0.34
44 0.35
45 0.34
46 0.31
47 0.32
48 0.31
49 0.33
50 0.26
51 0.19
52 0.18
53 0.19
54 0.21
55 0.2
56 0.19
57 0.17
58 0.15
59 0.14
60 0.1
61 0.1
62 0.12
63 0.12
64 0.12
65 0.12
66 0.12
67 0.13
68 0.14
69 0.12
70 0.09
71 0.11
72 0.12
73 0.13
74 0.14
75 0.13
76 0.13
77 0.13
78 0.13
79 0.1
80 0.09
81 0.08
82 0.08
83 0.1
84 0.11
85 0.21
86 0.25
87 0.34
88 0.42
89 0.43
90 0.49
91 0.54
92 0.63
93 0.61
94 0.66
95 0.66
96 0.61
97 0.6
98 0.54
99 0.47
100 0.38
101 0.32
102 0.23
103 0.16
104 0.16
105 0.14
106 0.18
107 0.19
108 0.21
109 0.29
110 0.37
111 0.44
112 0.46
113 0.51
114 0.53
115 0.53
116 0.53
117 0.47
118 0.42
119 0.37
120 0.34
121 0.31
122 0.25
123 0.24
124 0.21
125 0.18
126 0.13
127 0.1
128 0.09
129 0.11
130 0.14
131 0.14
132 0.21
133 0.22
134 0.25
135 0.29
136 0.3
137 0.32
138 0.31
139 0.36
140 0.3
141 0.33
142 0.38
143 0.39
144 0.46
145 0.49
146 0.55
147 0.56