Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2HZV6

Protein Details
Accession A0A1X2HZV6   
Localization Confidence High
Confidence Score 19.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-22HRPPHRPPKKDLPHTPPKRVLPBasic
79-114HPQNKVSPHTPPKKRPPYTPKKRPPYTPKIMSPPIHHydrophilic
NLS Segment(s)
PositionSequence
5-22HRPPKKDLPHTPPKRVLP
27-27K
29-29K
62-108PKIKSPPIHPQKRPPPIHPQNKVSPHTPPKKRPPYTPKKRPPYTPKI
Subcellular Location(s) nucl 16, mito 8, cyto 3
Family & Domain DBs
Amino Acid Sequences HRPPHRPPKKDLPHTPPKRVLPPYTPKIKSPPIHPQNKSPPIHPQKESSPIHPQKVLPPYTPKIKSPPIHPQKRPPPIHPQNKVSPHTPPKKRPPYTPKKRPPYTPKIMSPPIHPPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.87
3 0.84
4 0.79
5 0.77
6 0.73
7 0.69
8 0.67
9 0.68
10 0.67
11 0.69
12 0.65
13 0.59
14 0.6
15 0.63
16 0.57
17 0.54
18 0.58
19 0.57
20 0.65
21 0.64
22 0.66
23 0.68
24 0.74
25 0.68
26 0.59
27 0.6
28 0.59
29 0.63
30 0.56
31 0.49
32 0.44
33 0.52
34 0.51
35 0.44
36 0.46
37 0.45
38 0.45
39 0.43
40 0.4
41 0.37
42 0.42
43 0.39
44 0.3
45 0.32
46 0.32
47 0.38
48 0.39
49 0.36
50 0.37
51 0.44
52 0.45
53 0.47
54 0.55
55 0.57
56 0.65
57 0.66
58 0.69
59 0.7
60 0.77
61 0.75
62 0.68
63 0.69
64 0.7
65 0.76
66 0.73
67 0.69
68 0.68
69 0.71
70 0.7
71 0.61
72 0.59
73 0.59
74 0.63
75 0.66
76 0.67
77 0.7
78 0.78
79 0.8
80 0.82
81 0.83
82 0.84
83 0.86
84 0.88
85 0.88
86 0.88
87 0.9
88 0.9
89 0.89
90 0.88
91 0.87
92 0.84
93 0.81
94 0.79
95 0.81
96 0.73
97 0.67