Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2IWZ6

Protein Details
Accession A0A1X2IWZ6    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
4-30QERRQRNKTASAKYRAKKNQQHHDMRSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 26, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF00170  bZIP_1  
PROSITE View protein in PROSITE  
PS50217  BZIP  
PS00036  BZIP_BASIC  
Amino Acid Sequences LSLQERRQRNKTASAKYRAKKNQQHHDMRSVIHSLTKENDVLIRQLDQVKIENQQLKSTCDKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.77
3 0.74
4 0.8
5 0.79
6 0.8
7 0.78
8 0.79
9 0.8
10 0.8
11 0.84
12 0.77
13 0.75
14 0.66
15 0.58
16 0.5
17 0.4
18 0.3
19 0.23
20 0.2
21 0.14
22 0.14
23 0.15
24 0.13
25 0.11
26 0.13
27 0.12
28 0.13
29 0.12
30 0.12
31 0.13
32 0.15
33 0.16
34 0.16
35 0.18
36 0.19
37 0.22
38 0.27
39 0.32
40 0.3
41 0.36
42 0.37
43 0.39