Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2IXK4

Protein Details
Accession A0A1X2IXK4    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
116-142RSSNIGQTQQRRRRRTRSYDTDDPPPLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 10.166, nucl 10, mito 10, cyto_nucl 7.5
Family & Domain DBs
Amino Acid Sequences MMMPPKMMMPPTLILPPTLILPPTLMMPPTLMLPPTLILPPTLMLMLKSILTTNKRAYIQSSLQALSPLTEFYGQEAILGLQFANYQGRQKMDAELVNVLIDGGHKYRPPPGAMERSSNIGQTQQRRRRRTRSYDTDDPPPLPPPPPKLRQVYLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.18
4 0.16
5 0.15
6 0.13
7 0.1
8 0.1
9 0.1
10 0.11
11 0.12
12 0.1
13 0.09
14 0.1
15 0.1
16 0.11
17 0.11
18 0.09
19 0.09
20 0.09
21 0.09
22 0.1
23 0.1
24 0.09
25 0.08
26 0.08
27 0.09
28 0.08
29 0.08
30 0.07
31 0.06
32 0.07
33 0.07
34 0.07
35 0.07
36 0.07
37 0.11
38 0.13
39 0.17
40 0.18
41 0.23
42 0.24
43 0.24
44 0.26
45 0.27
46 0.27
47 0.27
48 0.27
49 0.22
50 0.21
51 0.21
52 0.19
53 0.14
54 0.12
55 0.08
56 0.06
57 0.06
58 0.06
59 0.07
60 0.08
61 0.07
62 0.07
63 0.07
64 0.06
65 0.05
66 0.05
67 0.04
68 0.03
69 0.03
70 0.04
71 0.06
72 0.06
73 0.08
74 0.1
75 0.11
76 0.12
77 0.13
78 0.14
79 0.15
80 0.16
81 0.15
82 0.14
83 0.13
84 0.12
85 0.11
86 0.09
87 0.06
88 0.05
89 0.05
90 0.06
91 0.07
92 0.08
93 0.09
94 0.15
95 0.18
96 0.18
97 0.22
98 0.28
99 0.35
100 0.36
101 0.4
102 0.36
103 0.39
104 0.38
105 0.34
106 0.28
107 0.26
108 0.29
109 0.34
110 0.44
111 0.49
112 0.58
113 0.66
114 0.75
115 0.8
116 0.84
117 0.86
118 0.85
119 0.87
120 0.86
121 0.87
122 0.82
123 0.81
124 0.74
125 0.65
126 0.57
127 0.49
128 0.42
129 0.38
130 0.39
131 0.39
132 0.44
133 0.49
134 0.54
135 0.59