Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2I9Z2

Protein Details
Accession A0A1X2I9Z2   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
97-130GLAEPGKGGRKQRKEKKNRAKKFRGTKKAAASGGBasic
NLS Segment(s)
PositionSequence
94-132ARVGLAEPGKGGRKQRKEKKNRAKKFRGTKKAAASGGKK
Subcellular Location(s) mito 18.5, cyto_mito 12.333, cyto 5, cyto_nucl 4.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MADASSVTIRTRKFITNRLLQRKQMVVDVIHPGLANLSREEIREKLGKMYKTNKDVVSVFGFKTHFGGGRTTGFGLVYDNVEALKKFEPKYRLARVGLAEPGKGGRKQRKEKKNRAKKFRGTKKAAASGGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.46
3 0.52
4 0.62
5 0.69
6 0.72
7 0.68
8 0.68
9 0.63
10 0.57
11 0.5
12 0.42
13 0.32
14 0.29
15 0.29
16 0.24
17 0.21
18 0.19
19 0.15
20 0.14
21 0.15
22 0.13
23 0.09
24 0.11
25 0.11
26 0.12
27 0.15
28 0.14
29 0.16
30 0.19
31 0.19
32 0.24
33 0.29
34 0.3
35 0.33
36 0.42
37 0.45
38 0.46
39 0.49
40 0.42
41 0.4
42 0.38
43 0.35
44 0.3
45 0.25
46 0.21
47 0.19
48 0.19
49 0.16
50 0.16
51 0.14
52 0.12
53 0.11
54 0.12
55 0.11
56 0.12
57 0.12
58 0.12
59 0.11
60 0.09
61 0.08
62 0.08
63 0.07
64 0.07
65 0.06
66 0.06
67 0.06
68 0.06
69 0.06
70 0.07
71 0.1
72 0.14
73 0.15
74 0.21
75 0.25
76 0.3
77 0.38
78 0.44
79 0.46
80 0.44
81 0.46
82 0.42
83 0.41
84 0.41
85 0.33
86 0.26
87 0.2
88 0.22
89 0.22
90 0.24
91 0.3
92 0.34
93 0.44
94 0.55
95 0.65
96 0.73
97 0.81
98 0.89
99 0.92
100 0.94
101 0.94
102 0.94
103 0.94
104 0.94
105 0.94
106 0.94
107 0.93
108 0.9
109 0.88
110 0.86
111 0.84
112 0.79