Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2IN11

Protein Details
Accession A0A1X2IN11   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
104-125QKLKSERQQFEKEKRQHANKISHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 9.5, mito 9, cyto_nucl 8, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037381  RFWD3  
IPR001841  Znf_RING  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0005634  C:nucleus  
GO:0004842  F:ubiquitin-protein transferase activity  
GO:0036297  P:interstrand cross-link repair  
GO:0016567  P:protein ubiquitination  
Pfam View protein in Pfam  
PF13639  zf-RING_2  
PROSITE View protein in PROSITE  
PS50089  ZF_RING_2  
Amino Acid Sequences MTNCIVCLDSLDTGPITALVCGHVFHHDCISPWVANRPQCPLCKKSTTQRRHTPLIPLFLEMTGQGKGLTGLQDTAALSSNAISQDQFRDQCNQLRNQLQTTLQKLKSERQQFEKEKRQHANKISAYQNIKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.08
4 0.07
5 0.07
6 0.07
7 0.07
8 0.08
9 0.08
10 0.13
11 0.14
12 0.15
13 0.18
14 0.17
15 0.18
16 0.2
17 0.22
18 0.18
19 0.17
20 0.24
21 0.26
22 0.29
23 0.3
24 0.34
25 0.36
26 0.41
27 0.46
28 0.43
29 0.44
30 0.46
31 0.48
32 0.51
33 0.57
34 0.6
35 0.64
36 0.7
37 0.7
38 0.69
39 0.67
40 0.65
41 0.58
42 0.54
43 0.45
44 0.36
45 0.31
46 0.25
47 0.24
48 0.15
49 0.13
50 0.07
51 0.07
52 0.05
53 0.05
54 0.05
55 0.06
56 0.06
57 0.05
58 0.05
59 0.05
60 0.06
61 0.06
62 0.06
63 0.07
64 0.06
65 0.06
66 0.06
67 0.07
68 0.07
69 0.07
70 0.07
71 0.07
72 0.1
73 0.14
74 0.15
75 0.16
76 0.2
77 0.23
78 0.29
79 0.33
80 0.34
81 0.36
82 0.41
83 0.42
84 0.39
85 0.39
86 0.38
87 0.39
88 0.41
89 0.44
90 0.4
91 0.42
92 0.43
93 0.47
94 0.52
95 0.56
96 0.55
97 0.55
98 0.63
99 0.68
100 0.75
101 0.79
102 0.77
103 0.78
104 0.81
105 0.82
106 0.81
107 0.8
108 0.8
109 0.75
110 0.74
111 0.69
112 0.67