Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1E7M1

Protein Details
Accession A0A0D1E7M1   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
55-81NSYGDQARPGRRKRNRGSRQRLSNLPTHydrophilic
NLS Segment(s)
PositionSequence
62-73RPGRRKRNRGSR
Subcellular Location(s) nucl 13, mito 7, cyto 5
Family & Domain DBs
KEGG uma:UMAG_10093  -  
Amino Acid Sequences MLSLPSTSSTATQTPTCHSSPPPPASQQELSSPASFDSRAEFPLAKVFDVESPTNSYGDQARPGRRKRNRGSRQRLSNLPTPPSPFGSHLGMPPPTPRSTPYNHVPRHRSRFTPRPTRRELAVENGEVPRSDPEQVYDTFLSAVDSFKKLAVRCGEIAAEIITQRGKKDWTVQVTKTALVLVCVFRPRWVLGAMNASYSVLRDPWRSYHHALYTVFIARFLIP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.3
3 0.29
4 0.29
5 0.3
6 0.35
7 0.42
8 0.46
9 0.46
10 0.46
11 0.48
12 0.51
13 0.51
14 0.45
15 0.4
16 0.39
17 0.37
18 0.33
19 0.3
20 0.24
21 0.23
22 0.21
23 0.17
24 0.16
25 0.14
26 0.15
27 0.17
28 0.17
29 0.15
30 0.22
31 0.22
32 0.18
33 0.17
34 0.17
35 0.17
36 0.21
37 0.21
38 0.16
39 0.2
40 0.21
41 0.21
42 0.19
43 0.18
44 0.18
45 0.18
46 0.24
47 0.25
48 0.33
49 0.41
50 0.49
51 0.58
52 0.64
53 0.73
54 0.76
55 0.81
56 0.83
57 0.86
58 0.89
59 0.88
60 0.89
61 0.84
62 0.8
63 0.74
64 0.7
65 0.63
66 0.56
67 0.48
68 0.42
69 0.38
70 0.34
71 0.31
72 0.26
73 0.25
74 0.24
75 0.23
76 0.2
77 0.21
78 0.19
79 0.17
80 0.18
81 0.18
82 0.17
83 0.17
84 0.18
85 0.19
86 0.22
87 0.27
88 0.33
89 0.4
90 0.43
91 0.49
92 0.53
93 0.58
94 0.63
95 0.6
96 0.58
97 0.55
98 0.6
99 0.62
100 0.66
101 0.66
102 0.65
103 0.68
104 0.64
105 0.59
106 0.54
107 0.48
108 0.43
109 0.38
110 0.31
111 0.27
112 0.25
113 0.23
114 0.18
115 0.17
116 0.12
117 0.1
118 0.11
119 0.1
120 0.11
121 0.14
122 0.14
123 0.17
124 0.15
125 0.14
126 0.13
127 0.13
128 0.12
129 0.1
130 0.1
131 0.08
132 0.09
133 0.09
134 0.11
135 0.14
136 0.13
137 0.19
138 0.21
139 0.22
140 0.22
141 0.23
142 0.22
143 0.18
144 0.19
145 0.14
146 0.11
147 0.08
148 0.08
149 0.09
150 0.1
151 0.1
152 0.12
153 0.13
154 0.14
155 0.22
156 0.28
157 0.35
158 0.4
159 0.41
160 0.46
161 0.46
162 0.44
163 0.37
164 0.31
165 0.23
166 0.18
167 0.18
168 0.13
169 0.14
170 0.17
171 0.17
172 0.17
173 0.19
174 0.19
175 0.19
176 0.2
177 0.19
178 0.19
179 0.25
180 0.24
181 0.22
182 0.22
183 0.2
184 0.18
185 0.17
186 0.15
187 0.11
188 0.13
189 0.16
190 0.19
191 0.25
192 0.31
193 0.37
194 0.4
195 0.46
196 0.47
197 0.5
198 0.47
199 0.43
200 0.41
201 0.4
202 0.35
203 0.27