Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8PD10

Protein Details
Accession B8PD10    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
5-29RLYSKGRVLGHKRAKRNTRPNTSLIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 11.333, nucl 11, mito 10.5, cyto_nucl 8.833, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038661  L35A_sf  
IPR001780  Ribosomal_L35A  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ppl:POSPLDRAFT_116399  -  
ppl:POSPLDRAFT_134689  -  
Pfam View protein in Pfam  
PF01247  Ribosomal_L35Ae  
Amino Acid Sequences MGSTRLYSKGRVLGHKRAKRNTRPNTSLIQIEGVSTKEDAQFYLGKRVAYVYRAKREVQGSKVRVIWGRVTRPHGNSGVVKSKFRSNLPPHVFGASVRVMLYPSAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.67
3 0.72
4 0.76
5 0.81
6 0.82
7 0.86
8 0.86
9 0.85
10 0.81
11 0.76
12 0.71
13 0.63
14 0.54
15 0.44
16 0.35
17 0.25
18 0.2
19 0.18
20 0.14
21 0.12
22 0.1
23 0.1
24 0.1
25 0.1
26 0.1
27 0.11
28 0.13
29 0.14
30 0.2
31 0.21
32 0.19
33 0.19
34 0.21
35 0.19
36 0.19
37 0.26
38 0.24
39 0.28
40 0.31
41 0.31
42 0.34
43 0.38
44 0.39
45 0.38
46 0.41
47 0.37
48 0.38
49 0.38
50 0.36
51 0.33
52 0.31
53 0.31
54 0.28
55 0.31
56 0.33
57 0.38
58 0.41
59 0.42
60 0.44
61 0.39
62 0.37
63 0.34
64 0.36
65 0.38
66 0.36
67 0.35
68 0.34
69 0.38
70 0.39
71 0.4
72 0.45
73 0.42
74 0.5
75 0.55
76 0.57
77 0.52
78 0.49
79 0.47
80 0.37
81 0.35
82 0.25
83 0.2
84 0.16
85 0.15
86 0.13