Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8PC64

Protein Details
Accession B8PC64    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
84-114VTHGRKRKRAGDASSKRRKGKAKARDTWTRWBasic
NLS Segment(s)
PositionSequence
87-108GRKRKRAGDASSKRRKGKAKAR
Subcellular Location(s) nucl 10.5, cyto_nucl 9.833, cyto 8, cyto_mito 7.833, mito 6.5
Family & Domain DBs
KEGG ppl:POSPLDRAFT_93987  -  
Amino Acid Sequences MPKRTKVPAALHSELSEYAALLRALRTNDALDLASQLTRASATPAPEDDQMYQDKDGNELDKPLPESAPQEDLVEDVYAMSASVTHGRKRKRAGDASSKRRKGKAKARDTWTRWPLLAGDVHVPEWGLEDEVKLFATTHLCSMSSASDHGHQPLVNDEDDVEDTGLPSSTINVLTSESADHLSRILALLAAHVPPGEKIMQNRVRPLGWEAVLDVVGASGLVDANIVQNVQRRLQTVYGPTSSNVVDRVQTTSSVEMRLDGVCSSHDLSFLTLSGFDPTNSLPKRPTRLSFVTKYLTGQYCSSQYPYCVICFVGGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.33
3 0.24
4 0.15
5 0.12
6 0.13
7 0.12
8 0.11
9 0.12
10 0.14
11 0.15
12 0.17
13 0.18
14 0.16
15 0.17
16 0.18
17 0.17
18 0.13
19 0.14
20 0.13
21 0.12
22 0.11
23 0.1
24 0.09
25 0.09
26 0.09
27 0.12
28 0.13
29 0.15
30 0.17
31 0.2
32 0.22
33 0.23
34 0.25
35 0.22
36 0.23
37 0.23
38 0.23
39 0.23
40 0.23
41 0.22
42 0.21
43 0.22
44 0.2
45 0.18
46 0.19
47 0.19
48 0.19
49 0.21
50 0.2
51 0.19
52 0.19
53 0.21
54 0.2
55 0.22
56 0.19
57 0.18
58 0.16
59 0.16
60 0.15
61 0.12
62 0.09
63 0.06
64 0.06
65 0.05
66 0.05
67 0.04
68 0.03
69 0.04
70 0.11
71 0.13
72 0.19
73 0.25
74 0.31
75 0.37
76 0.44
77 0.51
78 0.54
79 0.6
80 0.63
81 0.68
82 0.73
83 0.78
84 0.82
85 0.81
86 0.76
87 0.74
88 0.74
89 0.73
90 0.73
91 0.72
92 0.72
93 0.74
94 0.77
95 0.8
96 0.78
97 0.78
98 0.72
99 0.63
100 0.53
101 0.44
102 0.38
103 0.3
104 0.25
105 0.16
106 0.15
107 0.13
108 0.13
109 0.12
110 0.12
111 0.09
112 0.1
113 0.08
114 0.06
115 0.06
116 0.06
117 0.06
118 0.07
119 0.07
120 0.05
121 0.05
122 0.06
123 0.08
124 0.08
125 0.08
126 0.09
127 0.09
128 0.09
129 0.09
130 0.09
131 0.07
132 0.08
133 0.08
134 0.1
135 0.1
136 0.11
137 0.11
138 0.11
139 0.1
140 0.12
141 0.13
142 0.11
143 0.1
144 0.09
145 0.09
146 0.09
147 0.09
148 0.07
149 0.05
150 0.05
151 0.05
152 0.05
153 0.04
154 0.04
155 0.04
156 0.05
157 0.05
158 0.05
159 0.05
160 0.06
161 0.06
162 0.07
163 0.07
164 0.06
165 0.07
166 0.07
167 0.07
168 0.06
169 0.06
170 0.06
171 0.06
172 0.05
173 0.05
174 0.04
175 0.05
176 0.06
177 0.06
178 0.06
179 0.05
180 0.06
181 0.05
182 0.07
183 0.08
184 0.09
185 0.1
186 0.2
187 0.28
188 0.29
189 0.33
190 0.33
191 0.32
192 0.32
193 0.33
194 0.27
195 0.2
196 0.19
197 0.16
198 0.14
199 0.14
200 0.12
201 0.09
202 0.05
203 0.04
204 0.03
205 0.03
206 0.02
207 0.02
208 0.02
209 0.02
210 0.03
211 0.03
212 0.04
213 0.04
214 0.05
215 0.1
216 0.13
217 0.15
218 0.17
219 0.18
220 0.21
221 0.23
222 0.26
223 0.25
224 0.28
225 0.27
226 0.27
227 0.25
228 0.25
229 0.23
230 0.2
231 0.18
232 0.14
233 0.13
234 0.13
235 0.16
236 0.15
237 0.15
238 0.16
239 0.18
240 0.19
241 0.19
242 0.18
243 0.15
244 0.16
245 0.15
246 0.14
247 0.11
248 0.1
249 0.09
250 0.11
251 0.13
252 0.12
253 0.12
254 0.12
255 0.13
256 0.13
257 0.12
258 0.11
259 0.09
260 0.09
261 0.11
262 0.11
263 0.1
264 0.11
265 0.12
266 0.21
267 0.23
268 0.25
269 0.28
270 0.35
271 0.43
272 0.48
273 0.51
274 0.5
275 0.57
276 0.63
277 0.62
278 0.61
279 0.58
280 0.52
281 0.5
282 0.49
283 0.44
284 0.38
285 0.35
286 0.32
287 0.31
288 0.32
289 0.34
290 0.29
291 0.26
292 0.28
293 0.28
294 0.26
295 0.24
296 0.21