Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8PBF2

Protein Details
Accession B8PBF2    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
15-37FRVKSPEQRRHHPYKQCERPCEPBasic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 11, mito 7, cyto 4
Family & Domain DBs
KEGG ppl:POSPLDRAFT_103226  -  
Amino Acid Sequences MPKDISSTVKYQQLFRVKSPEQRRHHPYKQCERPCEPVPNTPVVVERLRKEVGERGERGISRKVTEFKEACLPPENSPKRGGRMTYGHPEGTVRFHFYQTFEINPNFLRKKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.45
3 0.49
4 0.47
5 0.55
6 0.63
7 0.64
8 0.62
9 0.68
10 0.73
11 0.74
12 0.79
13 0.79
14 0.79
15 0.8
16 0.84
17 0.83
18 0.82
19 0.77
20 0.75
21 0.71
22 0.7
23 0.62
24 0.57
25 0.52
26 0.47
27 0.43
28 0.36
29 0.32
30 0.26
31 0.26
32 0.23
33 0.21
34 0.22
35 0.22
36 0.21
37 0.21
38 0.22
39 0.25
40 0.27
41 0.26
42 0.25
43 0.27
44 0.28
45 0.29
46 0.29
47 0.24
48 0.2
49 0.23
50 0.25
51 0.24
52 0.31
53 0.29
54 0.26
55 0.33
56 0.32
57 0.31
58 0.32
59 0.32
60 0.28
61 0.39
62 0.41
63 0.34
64 0.4
65 0.4
66 0.4
67 0.41
68 0.39
69 0.34
70 0.36
71 0.39
72 0.42
73 0.43
74 0.38
75 0.35
76 0.35
77 0.3
78 0.3
79 0.26
80 0.24
81 0.22
82 0.24
83 0.26
84 0.26
85 0.31
86 0.29
87 0.3
88 0.29
89 0.28
90 0.29
91 0.3
92 0.37