Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2IBA2

Protein Details
Accession A0A1X2IBA2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
7-29KHTIVKKRTATFKRHQSNRFMRVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18.5, mito_nucl 11.333, cyto 5.5, cyto_nucl 4.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVTPAVKHTIVKKRTATFKRHQSNRFMRVGESWRKPKGIDSCVRRRFKGQAPMPKIGYGSAKKTRHMLPNGFRKFTVSNVRELDLLLMHNRSYAAEIAHNISSKNRVTILERAAQLNVKVINAGARLRSQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.68
3 0.68
4 0.68
5 0.74
6 0.77
7 0.8
8 0.79
9 0.79
10 0.81
11 0.79
12 0.75
13 0.65
14 0.56
15 0.52
16 0.54
17 0.53
18 0.51
19 0.51
20 0.49
21 0.49
22 0.48
23 0.49
24 0.49
25 0.48
26 0.48
27 0.49
28 0.57
29 0.65
30 0.69
31 0.63
32 0.59
33 0.57
34 0.56
35 0.58
36 0.55
37 0.56
38 0.58
39 0.61
40 0.58
41 0.52
42 0.45
43 0.35
44 0.33
45 0.25
46 0.25
47 0.3
48 0.3
49 0.31
50 0.34
51 0.37
52 0.39
53 0.42
54 0.42
55 0.41
56 0.5
57 0.53
58 0.5
59 0.45
60 0.41
61 0.37
62 0.36
63 0.38
64 0.28
65 0.3
66 0.31
67 0.31
68 0.29
69 0.28
70 0.24
71 0.14
72 0.14
73 0.1
74 0.09
75 0.08
76 0.09
77 0.09
78 0.08
79 0.09
80 0.09
81 0.09
82 0.09
83 0.11
84 0.13
85 0.15
86 0.15
87 0.14
88 0.15
89 0.19
90 0.18
91 0.19
92 0.18
93 0.18
94 0.22
95 0.27
96 0.3
97 0.32
98 0.32
99 0.32
100 0.32
101 0.32
102 0.28
103 0.26
104 0.23
105 0.17
106 0.16
107 0.14
108 0.16
109 0.16
110 0.18
111 0.16