Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2INY3

Protein Details
Accession A0A1X2INY3    Localization Confidence High Confidence Score 17.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-50MVPKKYKSKRGTAREYYKIEKRVREHHRKLRKEQKKNPQLRRKPKDPGIPBasic
81-103RLAQSEKDKKNKTFQKKPKESKAHydrophilic
NLS Segment(s)
PositionSequence
4-46KKYKSKRGTAREYYKIEKRVREHHRKLRKEQKKNPQLRRKPKD
74-103KKKQRAARLAQSEKDKKNKTFQKKPKESKA
Subcellular Location(s) nucl 21, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR014813  Gnl3_N_dom  
Pfam View protein in Pfam  
PF08701  GN3L_Grn1  
Amino Acid Sequences MVPKKYKSKRGTAREYYKIEKRVREHHRKLRKEQKKNPQLRRKPKDPGIPNNWPFKEELLNEVERHKQDLEEEKKKQRAARLAQSEKDKKNKTFQKKPKESKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.82
3 0.78
4 0.75
5 0.74
6 0.69
7 0.66
8 0.62
9 0.64
10 0.68
11 0.72
12 0.75
13 0.77
14 0.82
15 0.82
16 0.88
17 0.88
18 0.88
19 0.88
20 0.88
21 0.89
22 0.89
23 0.91
24 0.91
25 0.91
26 0.91
27 0.91
28 0.9
29 0.86
30 0.84
31 0.81
32 0.8
33 0.76
34 0.75
35 0.72
36 0.72
37 0.69
38 0.68
39 0.61
40 0.52
41 0.44
42 0.36
43 0.32
44 0.23
45 0.21
46 0.17
47 0.19
48 0.19
49 0.2
50 0.23
51 0.2
52 0.22
53 0.19
54 0.16
55 0.18
56 0.28
57 0.35
58 0.4
59 0.46
60 0.52
61 0.57
62 0.61
63 0.6
64 0.57
65 0.58
66 0.57
67 0.61
68 0.63
69 0.64
70 0.66
71 0.73
72 0.74
73 0.72
74 0.74
75 0.72
76 0.66
77 0.7
78 0.75
79 0.76
80 0.78
81 0.81
82 0.83
83 0.87