Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2ILD4

Protein Details
Accession A0A1X2ILD4    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
3-30ITSMQQLFEKKRRRRESHNAVERRRRDNHydrophilic
NLS Segment(s)
PositionSequence
12-27KKRRRRESHNAVERRR
Subcellular Location(s) nucl 23, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR011598  bHLH_dom  
IPR036638  HLH_DNA-bd_sf  
Gene Ontology GO:0046983  F:protein dimerization activity  
Pfam View protein in Pfam  
PF00010  HLH  
PROSITE View protein in PROSITE  
PS50888  BHLH  
CDD cd11387  bHLHzip_USF_MITF  
Amino Acid Sequences IIITSMQQLFEKKRRRRESHNAVERRRRDNINERILELSTLLPERDAIKNNKGTILRKSVEHIRMLHEEVGKCQHRIQELENMLGMYRMR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.75
3 0.8
4 0.84
5 0.86
6 0.86
7 0.89
8 0.87
9 0.85
10 0.87
11 0.83
12 0.78
13 0.72
14 0.64
15 0.61
16 0.62
17 0.63
18 0.62
19 0.57
20 0.52
21 0.48
22 0.45
23 0.37
24 0.27
25 0.18
26 0.1
27 0.09
28 0.08
29 0.06
30 0.07
31 0.09
32 0.1
33 0.15
34 0.17
35 0.21
36 0.25
37 0.25
38 0.29
39 0.3
40 0.31
41 0.31
42 0.34
43 0.31
44 0.28
45 0.31
46 0.35
47 0.35
48 0.36
49 0.33
50 0.31
51 0.33
52 0.34
53 0.34
54 0.3
55 0.27
56 0.26
57 0.33
58 0.31
59 0.3
60 0.3
61 0.3
62 0.3
63 0.33
64 0.34
65 0.35
66 0.35
67 0.35
68 0.33
69 0.3
70 0.26