Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2IHV3

Protein Details
Accession A0A1X2IHV3   
Localization Confidence Medium
Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
12-39DDPWWIGTCKRRNNGRNKHGRGHNKFVRHydrophilic
104-124RSVVSRRNRAPPPRFRFQKKIHydrophilic
NLS Segment(s)
PositionSequence
110-123RNRAPPPRFRFQKK
Subcellular Location(s) nucl 10cyto 10cyto_nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MTHYSAKGILCDDPWWIGTCKRRNNGRNKHGRGHNKFVRCINCYRCCPKDKAIKRFTIRNMVEAAAVRDLQEASIYEEYTIPKLYVKLHYCISCAIHARVVRVRSVVSRRNRAPPPRFRFQKKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.17
4 0.21
5 0.29
6 0.37
7 0.44
8 0.51
9 0.6
10 0.67
11 0.76
12 0.81
13 0.83
14 0.85
15 0.83
16 0.84
17 0.83
18 0.85
19 0.82
20 0.81
21 0.78
22 0.72
23 0.7
24 0.67
25 0.63
26 0.56
27 0.55
28 0.53
29 0.53
30 0.54
31 0.56
32 0.55
33 0.54
34 0.55
35 0.56
36 0.58
37 0.6
38 0.64
39 0.64
40 0.67
41 0.65
42 0.68
43 0.63
44 0.62
45 0.53
46 0.45
47 0.4
48 0.31
49 0.29
50 0.22
51 0.2
52 0.1
53 0.1
54 0.08
55 0.07
56 0.07
57 0.06
58 0.06
59 0.06
60 0.08
61 0.09
62 0.09
63 0.09
64 0.1
65 0.11
66 0.12
67 0.12
68 0.09
69 0.09
70 0.1
71 0.12
72 0.19
73 0.21
74 0.23
75 0.27
76 0.28
77 0.28
78 0.29
79 0.28
80 0.24
81 0.25
82 0.23
83 0.24
84 0.24
85 0.27
86 0.3
87 0.29
88 0.27
89 0.25
90 0.25
91 0.28
92 0.35
93 0.39
94 0.43
95 0.51
96 0.55
97 0.63
98 0.71
99 0.74
100 0.76
101 0.79
102 0.78
103 0.79
104 0.84