Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2IAC3

Protein Details
Accession A0A1X2IAC3   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
5-28GDSISAPGKSRKRKKTETSFFSGFHydrophilic
NLS Segment(s)
PositionSequence
13-19KSRKRKK
Subcellular Location(s) plas 17, mito 6, E.R. 3, cyto_mito 3, mito_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013862  Kei1  
Gene Ontology GO:0016020  C:membrane  
GO:0070917  F:inositol phosphoceramide synthase regulator activity  
GO:0006673  P:inositol phosphoceramide metabolic process  
Pfam View protein in Pfam  
PF08552  Kei1  
Amino Acid Sequences MVTFGDSISAPGKSRKRKKTETSFFSGFSNSEDLFIMSFSKPQTCCFSIPLSTGVLIITIFGILNKLSGFYGLISFDFSDPVAFAVYIYSLLAVFVCAYGLYGLHTVKWVIGKRQRADC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.59
3 0.66
4 0.75
5 0.84
6 0.87
7 0.89
8 0.85
9 0.83
10 0.76
11 0.67
12 0.58
13 0.49
14 0.38
15 0.29
16 0.25
17 0.16
18 0.14
19 0.13
20 0.12
21 0.11
22 0.11
23 0.11
24 0.08
25 0.1
26 0.1
27 0.14
28 0.14
29 0.16
30 0.22
31 0.22
32 0.23
33 0.23
34 0.25
35 0.22
36 0.22
37 0.21
38 0.16
39 0.14
40 0.12
41 0.1
42 0.08
43 0.06
44 0.05
45 0.04
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.04
52 0.03
53 0.04
54 0.04
55 0.04
56 0.05
57 0.05
58 0.05
59 0.05
60 0.06
61 0.06
62 0.07
63 0.07
64 0.07
65 0.07
66 0.06
67 0.06
68 0.06
69 0.06
70 0.05
71 0.05
72 0.05
73 0.05
74 0.05
75 0.05
76 0.04
77 0.04
78 0.04
79 0.04
80 0.04
81 0.04
82 0.04
83 0.04
84 0.03
85 0.04
86 0.04
87 0.04
88 0.06
89 0.08
90 0.08
91 0.08
92 0.1
93 0.1
94 0.11
95 0.18
96 0.2
97 0.27
98 0.35
99 0.44