Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2HR15

Protein Details
Accession A0A1X2HR15   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
51-70IPRRRLQRGWWQQQQQQQQRHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 13, mito 4, extr 4, E.R. 2, golg 2, mito_nucl 2
Family & Domain DBs
Amino Acid Sequences FFSFLSLFSFVYLRPILFILQTTRCIRPLYQVVKKPLPCFIFCRFCKVSLIPRRRLQRGWWQQQQQQQQRRQV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.12
4 0.12
5 0.13
6 0.13
7 0.14
8 0.2
9 0.22
10 0.23
11 0.25
12 0.26
13 0.24
14 0.26
15 0.32
16 0.35
17 0.39
18 0.43
19 0.47
20 0.52
21 0.54
22 0.49
23 0.47
24 0.41
25 0.36
26 0.34
27 0.35
28 0.38
29 0.36
30 0.43
31 0.38
32 0.37
33 0.39
34 0.37
35 0.4
36 0.41
37 0.49
38 0.49
39 0.55
40 0.61
41 0.63
42 0.64
43 0.6
44 0.61
45 0.64
46 0.67
47 0.69
48 0.69
49 0.7
50 0.76
51 0.8
52 0.79
53 0.78