Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2I172

Protein Details
Accession A0A1X2I172   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
12-40RLSIVKAKEKIKTKKKNKKWGAPTIKSHHBasic
43-68HCHTCTVQYKHRRHHHQHHHHHSWLHBasic
NLS Segment(s)
PositionSequence
17-32KAKEKIKTKKKNKKWG
Subcellular Location(s) mito 15.5, mito_nucl 13.833, nucl 11, cyto_nucl 6.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR013087  Znf_C2H2_type  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
Amino Acid Sequences MSNTISVGSWPRLSIVKAKEKIKTKKKNKKWGAPTIKSHHNAHCHTCTVQYKHRRHHHQHHHHHSWLHPWIGLYMLSVQCCYK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.29
3 0.36
4 0.41
5 0.45
6 0.51
7 0.58
8 0.68
9 0.71
10 0.75
11 0.76
12 0.81
13 0.87
14 0.91
15 0.91
16 0.91
17 0.9
18 0.9
19 0.89
20 0.84
21 0.82
22 0.76
23 0.74
24 0.68
25 0.62
26 0.55
27 0.52
28 0.47
29 0.44
30 0.4
31 0.34
32 0.31
33 0.33
34 0.34
35 0.32
36 0.38
37 0.44
38 0.49
39 0.57
40 0.66
41 0.71
42 0.74
43 0.8
44 0.83
45 0.85
46 0.88
47 0.89
48 0.87
49 0.81
50 0.75
51 0.66
52 0.62
53 0.56
54 0.46
55 0.37
56 0.3
57 0.26
58 0.24
59 0.22
60 0.15
61 0.15
62 0.16
63 0.16