Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2I108

Protein Details
Accession A0A1X2I108    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MAKEKTTKKTKRPSPYNMYMKAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, mito_nucl 12.166, mito 10.5, cyto_nucl 8.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR036910  HMG_box_dom_sf  
IPR006780  YABBY  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF04690  YABBY  
CDD cd00084  HMG-box_SF  
Amino Acid Sequences MAKEKTTKKTKRPSPYNMYMKAELGKVKKDNPGMTHKEAFKKVAESWATAPENPKNKKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.86
3 0.84
4 0.8
5 0.75
6 0.65
7 0.57
8 0.49
9 0.41
10 0.35
11 0.28
12 0.27
13 0.24
14 0.25
15 0.29
16 0.3
17 0.31
18 0.3
19 0.37
20 0.38
21 0.4
22 0.42
23 0.41
24 0.44
25 0.44
26 0.42
27 0.36
28 0.33
29 0.29
30 0.32
31 0.3
32 0.26
33 0.27
34 0.33
35 0.33
36 0.31
37 0.35
38 0.35
39 0.43