Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2ID85

Protein Details
Accession A0A1X2ID85    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
9-36IYTEANRKPLRKPRNRKRDPSSAPRPVNHydrophilic
NLS Segment(s)
PositionSequence
15-28RKPLRKPRNRKRDP
102-106PKRKR
Subcellular Location(s) nucl 12.5, cyto_nucl 10.5, cyto 7.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01389  HMG-box_ROX1-like  
Amino Acid Sequences MKDVEDLIIYTEANRKPLRKPRNRKRDPSSAPRPVNCFLVYRKEKQAQIAELCTGANHRVISKIVARWWKNIDSCTRSLYVDVAKQVKQDHAIKFPGYKYAPKRKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.28
3 0.36
4 0.47
5 0.57
6 0.61
7 0.71
8 0.76
9 0.84
10 0.91
11 0.92
12 0.89
13 0.89
14 0.87
15 0.86
16 0.85
17 0.84
18 0.79
19 0.72
20 0.69
21 0.6
22 0.54
23 0.45
24 0.37
25 0.29
26 0.34
27 0.34
28 0.34
29 0.39
30 0.4
31 0.41
32 0.42
33 0.44
34 0.37
35 0.35
36 0.32
37 0.26
38 0.21
39 0.19
40 0.14
41 0.11
42 0.08
43 0.08
44 0.07
45 0.07
46 0.08
47 0.09
48 0.11
49 0.13
50 0.14
51 0.18
52 0.26
53 0.27
54 0.29
55 0.33
56 0.36
57 0.35
58 0.36
59 0.39
60 0.36
61 0.36
62 0.35
63 0.33
64 0.29
65 0.27
66 0.26
67 0.22
68 0.2
69 0.23
70 0.24
71 0.23
72 0.25
73 0.27
74 0.27
75 0.31
76 0.34
77 0.34
78 0.36
79 0.38
80 0.38
81 0.4
82 0.38
83 0.4
84 0.37
85 0.41
86 0.46