Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2I2Y6

Protein Details
Accession A0A1X2I2Y6    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
4-26EESTETPRKRNSGRRKIKIEYIEHydrophilic
NLS Segment(s)
PositionSequence
11-23RKRNSGRRKIKIE
27-40DKNRRHITFSKRKA
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR033897  MADS_SRF-like  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0000987  F:cis-regulatory region sequence-specific DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0046983  F:protein dimerization activity  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
PROSITE View protein in PROSITE  
PS00350  MADS_BOX_1  
PS50066  MADS_BOX_2  
CDD cd00266  MADS_SRF_like  
Amino Acid Sequences DSDEESTETPRKRNSGRRKIKIEYIEDKNRRHITFSKRKAGIMKKAYELSTLTGTQVLLLVVSETGLVYTFTTVKLQPIVTKPEGKSLIQACLNAPDPGMESGGAMMVSSHLWLPRVVSCIYPISVRFE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.67
3 0.75
4 0.81
5 0.84
6 0.82
7 0.82
8 0.79
9 0.75
10 0.73
11 0.7
12 0.71
13 0.7
14 0.67
15 0.67
16 0.66
17 0.59
18 0.55
19 0.54
20 0.54
21 0.58
22 0.64
23 0.64
24 0.59
25 0.61
26 0.64
27 0.64
28 0.63
29 0.59
30 0.53
31 0.47
32 0.48
33 0.46
34 0.39
35 0.32
36 0.25
37 0.2
38 0.17
39 0.14
40 0.12
41 0.11
42 0.1
43 0.09
44 0.07
45 0.04
46 0.04
47 0.04
48 0.03
49 0.03
50 0.03
51 0.02
52 0.02
53 0.03
54 0.03
55 0.03
56 0.04
57 0.04
58 0.05
59 0.06
60 0.07
61 0.07
62 0.09
63 0.09
64 0.12
65 0.14
66 0.2
67 0.22
68 0.27
69 0.27
70 0.32
71 0.34
72 0.31
73 0.34
74 0.29
75 0.31
76 0.27
77 0.27
78 0.21
79 0.22
80 0.24
81 0.18
82 0.17
83 0.12
84 0.13
85 0.13
86 0.13
87 0.09
88 0.08
89 0.08
90 0.08
91 0.07
92 0.05
93 0.04
94 0.04
95 0.04
96 0.05
97 0.06
98 0.07
99 0.08
100 0.08
101 0.11
102 0.13
103 0.16
104 0.16
105 0.16
106 0.18
107 0.2
108 0.22
109 0.22