Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2IT04

Protein Details
Accession A0A1X2IT04    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
30-55LLECKTRYDTNRKRRRCCKAECTDCIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 9.5, cyto_nucl 9, cyto 7.5, pero 6, mito 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MIDGGVTVSDFFATWLPPPGVILLNKILHLLECKTRYDTNRKRRRCCKAECTDCIDGGVTVSDFFATWLPPPVLFLLNKILHLLDSNSFYFLPSEKGMAAFVPIKFATIFLLYSTGIFLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.13
3 0.13
4 0.13
5 0.13
6 0.14
7 0.17
8 0.16
9 0.18
10 0.18
11 0.19
12 0.19
13 0.19
14 0.17
15 0.14
16 0.16
17 0.16
18 0.18
19 0.19
20 0.21
21 0.24
22 0.28
23 0.33
24 0.42
25 0.5
26 0.54
27 0.63
28 0.7
29 0.77
30 0.82
31 0.88
32 0.85
33 0.84
34 0.83
35 0.84
36 0.83
37 0.77
38 0.74
39 0.64
40 0.55
41 0.46
42 0.36
43 0.25
44 0.16
45 0.13
46 0.05
47 0.04
48 0.04
49 0.04
50 0.04
51 0.05
52 0.06
53 0.07
54 0.07
55 0.09
56 0.1
57 0.09
58 0.1
59 0.1
60 0.11
61 0.11
62 0.12
63 0.16
64 0.17
65 0.17
66 0.17
67 0.15
68 0.13
69 0.14
70 0.14
71 0.09
72 0.12
73 0.12
74 0.13
75 0.13
76 0.13
77 0.13
78 0.12
79 0.14
80 0.12
81 0.12
82 0.11
83 0.12
84 0.12
85 0.11
86 0.13
87 0.14
88 0.13
89 0.16
90 0.15
91 0.16
92 0.16
93 0.16
94 0.15
95 0.13
96 0.13
97 0.1
98 0.12
99 0.11
100 0.11