Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2I058

Protein Details
Accession A0A1X2I058    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
2-28CFYYEKITPKRYRYKLCKHKDVRFDEEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 13, cyto 8
Family & Domain DBs
Amino Acid Sequences MCFYYEKITPKRYRYKLCKHKDVRFDEESGELKTTYYFPENLQTYLDTHHITLPPTDEWVYVKDEFLDENVKSFSCNNLPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.83
3 0.85
4 0.87
5 0.89
6 0.87
7 0.86
8 0.85
9 0.82
10 0.78
11 0.71
12 0.62
13 0.52
14 0.47
15 0.4
16 0.31
17 0.25
18 0.17
19 0.14
20 0.13
21 0.13
22 0.11
23 0.11
24 0.1
25 0.1
26 0.16
27 0.17
28 0.17
29 0.17
30 0.16
31 0.14
32 0.15
33 0.17
34 0.11
35 0.11
36 0.12
37 0.13
38 0.13
39 0.13
40 0.14
41 0.12
42 0.14
43 0.14
44 0.13
45 0.13
46 0.14
47 0.18
48 0.16
49 0.16
50 0.14
51 0.14
52 0.14
53 0.14
54 0.17
55 0.13
56 0.15
57 0.16
58 0.15
59 0.16
60 0.17
61 0.2