Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2IU68

Protein Details
Accession A0A1X2IU68    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPTRLHHNRKKRGHVSAGHGBasic
NLS Segment(s)
PositionSequence
8-33NRKKRGHVSAGHGRVGKHRKHPGGRG
Subcellular Location(s) nucl 10, mito 10, mito_nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR036227  L18e/L15P_sf  
IPR001196  Ribosomal_L15_CS  
IPR021131  Ribosomal_L18e/L15P  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00828  Ribosomal_L27A  
PROSITE View protein in PROSITE  
PS00475  RIBOSOMAL_L15  
Amino Acid Sequences MPTRLHHNRKKRGHVSAGHGRVGKHRKHPGGRGLAGGQHHHRINMDKYHPGYFGKVGMRTFHLKKNTKWRPVVNLDQIWTLAGEGVREQYKNTEKVPVVDALQNGYGKVLAKGRVAQPVIVRTRFVSRRAEEKIKAAGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.78
3 0.78
4 0.73
5 0.67
6 0.6
7 0.52
8 0.53
9 0.54
10 0.52
11 0.51
12 0.56
13 0.6
14 0.65
15 0.71
16 0.71
17 0.71
18 0.66
19 0.6
20 0.51
21 0.45
22 0.4
23 0.36
24 0.3
25 0.27
26 0.26
27 0.24
28 0.24
29 0.26
30 0.28
31 0.32
32 0.32
33 0.31
34 0.33
35 0.34
36 0.34
37 0.3
38 0.28
39 0.21
40 0.22
41 0.19
42 0.19
43 0.18
44 0.18
45 0.2
46 0.24
47 0.26
48 0.27
49 0.34
50 0.36
51 0.4
52 0.5
53 0.56
54 0.58
55 0.61
56 0.58
57 0.55
58 0.57
59 0.58
60 0.53
61 0.46
62 0.39
63 0.34
64 0.32
65 0.25
66 0.19
67 0.12
68 0.07
69 0.06
70 0.05
71 0.05
72 0.07
73 0.08
74 0.08
75 0.09
76 0.14
77 0.19
78 0.22
79 0.23
80 0.27
81 0.26
82 0.28
83 0.3
84 0.26
85 0.23
86 0.22
87 0.22
88 0.17
89 0.19
90 0.17
91 0.15
92 0.13
93 0.12
94 0.1
95 0.12
96 0.14
97 0.14
98 0.16
99 0.2
100 0.23
101 0.29
102 0.29
103 0.29
104 0.29
105 0.35
106 0.39
107 0.36
108 0.35
109 0.3
110 0.38
111 0.4
112 0.41
113 0.42
114 0.39
115 0.46
116 0.54
117 0.6
118 0.53
119 0.54