Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2I6S0

Protein Details
Accession A0A1X2I6S0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MTNKCNQHSQQHRKNQSNIGRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito_nucl 12.833, mito 10.5, cyto_nucl 8.833
Family & Domain DBs
Amino Acid Sequences MTNKCNQHSQQHRKNQSNIGRNYYGIPGINTSGGQCSWCGKYGHKPSYCPYLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.81
3 0.78
4 0.77
5 0.71
6 0.66
7 0.58
8 0.51
9 0.46
10 0.38
11 0.3
12 0.21
13 0.17
14 0.11
15 0.1
16 0.1
17 0.08
18 0.08
19 0.08
20 0.08
21 0.08
22 0.08
23 0.1
24 0.11
25 0.15
26 0.17
27 0.19
28 0.29
29 0.39
30 0.48
31 0.49
32 0.51
33 0.52