Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2IK77

Protein Details
Accession A0A1X2IK77    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
82-114LLDEKKQKQKTTKPTHRQFHRKKNRDAIKLENFHydrophilic
NLS Segment(s)
PositionSequence
89-106KQKTTKPTHRQFHRKKNR
Subcellular Location(s) mito 15.5, mito_nucl 13.166, nucl 9.5, cyto_nucl 6.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MLSSVRQTLRQRICVRRSYLHSTSTVANQTTSFSAEGTTQAQSRKPSSVPAGVTLNGINFLKDGKDPIALEDTEYPMWLWDLLDEKKQKQKTTKPTHRQFHRKKNRDAIKLENFMKDKKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.71
3 0.68
4 0.68
5 0.67
6 0.63
7 0.56
8 0.5
9 0.45
10 0.41
11 0.37
12 0.34
13 0.26
14 0.23
15 0.2
16 0.19
17 0.18
18 0.18
19 0.14
20 0.1
21 0.1
22 0.1
23 0.11
24 0.11
25 0.12
26 0.12
27 0.13
28 0.16
29 0.19
30 0.21
31 0.22
32 0.2
33 0.22
34 0.24
35 0.26
36 0.24
37 0.23
38 0.23
39 0.21
40 0.21
41 0.17
42 0.14
43 0.11
44 0.1
45 0.08
46 0.06
47 0.06
48 0.06
49 0.06
50 0.07
51 0.06
52 0.09
53 0.09
54 0.1
55 0.12
56 0.12
57 0.13
58 0.12
59 0.14
60 0.11
61 0.12
62 0.1
63 0.08
64 0.08
65 0.07
66 0.06
67 0.05
68 0.1
69 0.11
70 0.17
71 0.21
72 0.25
73 0.33
74 0.38
75 0.43
76 0.48
77 0.56
78 0.61
79 0.7
80 0.77
81 0.8
82 0.85
83 0.89
84 0.91
85 0.92
86 0.92
87 0.92
88 0.92
89 0.91
90 0.9
91 0.91
92 0.9
93 0.88
94 0.83
95 0.81
96 0.79
97 0.78
98 0.72
99 0.69
100 0.62